DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and F43C11.8

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:NP_494244.2 Gene:F43C11.8 / 173590 WormBaseID:WBGene00018385 Length:323 Species:Caenorhabditis elegans


Alignment Length:340 Identity:69/340 - (20%)
Similarity:113/340 - (33%) Gaps:113/340 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 FIECPVCKQETPLGPKGIKALPCDYIVTNILDLSNLESEHIVCTSCKSKEEAISRCNDCANFLCN 284
            ||||.:|.:                      |.|:            :.:|.|.|...|.:.:|:
 Worm     3 FIECEICNE----------------------DFSS------------ATDENIPRILRCGHTICH 33

  Fly   285 GCDNAHKYMR--------CFENHHVVRIEDLTKN-------------VHDKLIIHKPVFCPQHVS 328
            ||  |.|.::        |.|..:|..::||.||             ..:|..|..|..|..|  
 Worm    34 GC--AEKLLQNSMILCPFCREATNVSTVKDLQKNFALLQAVEHAKTRTEEKDPIDSPPKCASH-- 94

  Fly   329 ENLKYYCFTCQVPTCNDCLLSDHKGSDHHYETATVAEQAVRADLEETLSDTLKKADYCNDAGSNL 393
             ...:..|.|..|||:.                               ||.| ....|.:.|::.
 Worm    95 -QYNFAEFVCIEPTCSS-------------------------------SDKL-MCRTCEEFGAHA 126

  Fly   394 GSALTELQSQHDTVRQ-------QIEDAYKCYKRMLESIKDQMLNEL--GRLHSDRELKIMDLMQ 449
            |.....|||:...:||       :.||........:|.|....|..|  |.:..::::.|:....
 Worm   127 GHNRGLLQSEAAKLRQFLSGKLSRSEDLASKIDANIEKIGTAQLTNLDDGEVFQEKKVSIIAFYA 191

  Fly   450 SMENTMGKLQHAAQFGQRAVDKANSIEFLLLKPIISAQC---------LNLMEQTPKCD---INY 502
            |:..|:..|::.|....:.:.:.|.....||...:|...         |.|..:....|   :|.
 Worm   192 SIRETLDALENDALATLQNIAETNFFTNDLLIAELSESLNRQKRKSAELKLFMKMSNADLLAVNS 256

  Fly   503 QLQFDSKPEMFEQFA 517
            .|:..|:.|::.:||
 Worm   257 ALEVSSENELWTEFA 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325 5/9 (56%)
BBOX 321..360 CDD:237988 7/38 (18%)
BBC 369..494 CDD:128778 29/142 (20%)
NHL_brat_like 913..1186 CDD:271329
NHL repeat 936..972 CDD:271329
NHL repeat 983..1025 CDD:271329
NHL repeat 1028..1064 CDD:271329
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
F43C11.8NP_494244.2 RING_Ubox 5..52 CDD:388418 15/82 (18%)
modified RING-HC finger (C3HC3D-type) 6..50 CDD:319361 13/79 (16%)
Bbox2_TRIM23_C-IX_rpt2 88..137 CDD:380832 17/83 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.