DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and ftr80

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:XP_017214326.1 Gene:ftr80 / 101883527 ZFINID:ZDB-GENE-090511-1 Length:584 Species:Danio rerio


Alignment Length:344 Identity:74/344 - (21%)
Similarity:127/344 - (36%) Gaps:98/344 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 CKLCSLRLVMPRILSCLHVFCEDCLQAVVSKDTMSASSPNSCSSSSFDGSEHQNRLSAVFIECPV 225
            |.:|...|..|...:|.|.||.|||                  :..:||.:.:...|     ||.
Zfish    13 CPICLHLLKNPVTTTCGHSFCMDCL------------------NGFWDGDDQKGVYS-----CPQ 54

  Fly   226 CKQETPLGP------------KGIKA------LPCDYIVTNILDLS-NLESEHIVCTSCKSKEEA 271
            |:......|            :|:|.      .|....|:.:|..: :::.|..:||..|.|  |
Zfish    55 CRHSFSPRPDLCRNIVLAAVVEGMKIKTPEKDAPEKASVSPVLSFAMSVDVECDICTETKLK--A 117

  Fly   272 ISRCNDCANFLCNGCDNAHKYMRCFENHHVVRIEDLTKNVHDKLIIHKPVFCPQHVSENLKYYCF 336
            |..|..|....|......|......:.|   ::.:.:..:.|::       |.|| .:.|:.||.
Zfish   118 IKSCLVCLASYCESHIQTHYTSPALKWH---KLANASPRLLDQI-------CSQH-HKPLELYCC 171

  Fly   337 TCQVPTCNDCLLSDHKGSDHHYETATVAEQAVRADLEETLSDTLKKADYCNDAGSNLGSALTELQ 401
            ..:...|..|.|.:|:   :|..|:..||   |.:::|.|.  ||:            ..|.|..
Zfish   172 QDRQLICMQCALINHQ---NHSMTSPAAE---RQNIQEQLK--LKR------------DGLQEDV 216

  Fly   402 SQHDTVRQQIEDAYKCYKRMLESIK---DQMLNELGRLHS--DRELKIMDLMQSMENTMGKLQHA 461
            .|.:...::::.|...|||..::..   ::|..|  ::||  .|...|..::::.||.       
Zfish   217 LQREVKVKELKQAKDFYKRSTQAAVVHCEEMFTE--QIHSMGKRRAGITKMIRAQENV------- 272

  Fly   462 AQFGQRAVDKANSIEFLLL 480
                     :.|.:|.|:|
Zfish   273 ---------EVNRVEDLIL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325 17/68 (25%)
BBOX 321..360 CDD:237988 11/38 (29%)
BBC 369..494 CDD:128778 24/117 (21%)
NHL_brat_like 913..1186 CDD:271329
NHL repeat 936..972 CDD:271329
NHL repeat 983..1025 CDD:271329
NHL repeat 1028..1064 CDD:271329
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
ftr80XP_017214326.1 RING 13..55 CDD:302633 16/64 (25%)
zf-B_box 157..193 CDD:279037 11/46 (24%)
SPRY 388..576 CDD:295394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR25462
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.