DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mei-P26 and rnf207a

DIOPT Version :9

Sequence 1:NP_001356936.1 Gene:mei-P26 / 45775 FlyBaseID:FBgn0026206 Length:1310 Species:Drosophila melanogaster
Sequence 2:XP_005169403.1 Gene:rnf207a / 100001767 ZFINID:ZDB-GENE-120813-7 Length:209 Species:Danio rerio


Alignment Length:173 Identity:27/173 - (15%)
Similarity:63/173 - (36%) Gaps:44/173 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 CDNAHKYMRCFENHHVVRIEDLTKNVHDKLIIHKPVFCPQHVSENLKYYCFTCQVPTCNDCLLSD 350
            |.|..|..|..:. .:.|::|..:.:|..|..|..:.....::|.|:            .|||.|
Zfish    41 CRNFEKSYRSLQT-EIQRLKDEVQEMHRDLTKHHSLINTDTMNEILE------------RCLLID 92

  Fly   351 HKGSDHH-----------------YETATVAEQAVRADLEETLSDTLKKAD-YCNDAGSNLGSAL 397
            .:.:..:                 ::..|..::...|.|.:.|.  ||:.: |.......:|..:
Zfish    93 EQIASQYSAVQTQRTVFEEKWDVTFQRVTNEQEIYEAQLHDLLQ--LKQENSYLTTIARQIGPYI 155

  Fly   398 TELQSQHDTVRQQIEDAYKCYKRMLESIKDQMLNELGRLHSDR 440
            ..:..    |::::|..:       :..::..::...::|.|:
Zfish   156 LSIAK----VKERLEPRF-------QKPENDCIDTTVKIHEDQ 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mei-P26NP_001356936.1 RING_Ubox 158..230 CDD:354325
BBOX 321..360 CDD:237988 6/55 (11%)
BBC 369..494 CDD:128778 11/73 (15%)
NHL_brat_like 913..1186 CDD:271329
NHL repeat 936..972 CDD:271329
NHL repeat 983..1025 CDD:271329
NHL repeat 1028..1064 CDD:271329
NHL repeat 1068..1107 CDD:271329
NHL repeat 1112..1151 CDD:271329
NHL repeat 1157..1183 CDD:271329
rnf207aXP_005169403.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D489543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.