DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment AgaP_AGAP007538 and CG13605

DIOPT Version :9

Sequence 1:XP_001237062.2 Gene:AgaP_AGAP007538 / 4576491 VectorBaseID:AGAP007538 Length:703 Species:Anopheles gambiae
Sequence 2:NP_651214.2 Gene:CG13605 / 42858 FlyBaseID:FBgn0039150 Length:669 Species:Drosophila melanogaster


Alignment Length:375 Identity:74/375 - (19%)
Similarity:134/375 - (35%) Gaps:138/375 - (36%)


- Green bases have known domain annotations that are detailed below.


Mosquito    95 IFYKFI--FVFGVVNVQYLYEVILWVSWFSALGFLHLLSQ-----LSKDRF---------EYLSF 143
            :|:||:  .:.|:|::..|..|:..|: .|....:..|:|     :.:|.|         .:|:.
  Fly   360 LFFKFLHDHLLGIVDLLVLQTVMYNVN-RSVRNQVARLAQKNYAVMVRDTFLVAVVVTVRLFLAT 423

Mosquito   144 SPTTPGWSHFRLI------SLLVAILAL---------------------------SGLMVGISIG 175
            ||..|    |.||      |:.:.:.||                           ..|.| |.:|
  Fly   424 SPPDP----FGLIVPPSRKSVFIEVTALPFHTSSEGDSPTTSSEPIKTNMYKDTYKSLNV-IPLG 483

Mosquito   176 VGVFFGGFNTFAFMAAECILLSIRTLHVLIRYGMFLHDMRQGGIANESISWDKRGPVAYYIELTF 240
            :.::        ::|...:::.:.|:.|.:...|..|.:                       :..
  Fly   484 MLLY--------YIAVSDLIIKLLTMLVKLIITMLPHHL-----------------------MRL 517

Mosquito   241 EVAALMVELVHYIHMML--------WSNIFL--SMASLVI----LMQLRYLLNEIQRKIKKHRNY 291
            :|.|.:..||.||....        |. :||  |.:.|.:    |....||..:|...:::.::.
  Fly   518 KVRARLYVLVEYISQFYRAMTPITQWL-LFLYESYSGLEVVSGGLFSAMYLGAKIFELVERGKSL 581

Mosquito   292 LWVL----NHMEKSYPLASSDDLKQNSDNCAICWEKMETARKLPCAHLFHNSCLQSWLEQDTSCP 352
            ...:    .:::...| .:.|:|......|.||.:...|...|.|.|:|.:.|:|:|.:::.:||
  Fly   582 KKAIVTFRKNIDSERP-PTKDELDAAGALCPICHDAFNTPTVLECGHIFCDECVQTWFKREQTCP 645

Mosquito   353 TCRLGLSVHQNGGPRGSPLLPDDIRIDD---QDGAVGGGGGRTANNHFFH 399
            .||..:|                   ||   |||          :..|||
  Fly   646 MCRAKVS-------------------DDPAWQDG----------STTFFH 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AgaP_AGAP007538XP_001237062.2 HRD1 49..>370 CDD:227568 66/341 (19%)
TDT <99..211 CDD:296283 29/160 (18%)
zf-RING_2 315..355 CDD:290367 13/39 (33%)
CUE_AMFR 444..484 CDD:270604
CG13605NP_651214.2 RING 610..651 CDD:238093 15/40 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5243
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D897451at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.