DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta'COP and Y41C4A.32

DIOPT Version :9

Sequence 1:NP_524836.2 Gene:beta'COP / 45757 FlyBaseID:FBgn0025724 Length:914 Species:Drosophila melanogaster
Sequence 2:NP_499518.2 Gene:Y41C4A.32 / 189814 WormBaseID:WBGene00270321 Length:291 Species:Caenorhabditis elegans


Alignment Length:288 Identity:127/288 - (44%)
Similarity:196/288 - (68%) Gaps:7/288 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SRSDRVKCVDLHPAEPWMLCALYNGHVHIMNYENQQMVKDFEVCDVPVRSARFVARKNWILTGSD 77
            |.|||||.||.|..:||:|.||:.|:|.|.||:.:.:||..||.:...|:|:|:.|||||.|.||
 Worm    10 SHSDRVKSVDFHSEKPWILTALHTGNVQIWNYDTKTLVKAMEVSEKSTRAAKFIHRKNWIATASD 74

  Fly    78 DMQIRVFNYNTLEKVHSFEAHSDYLRCIAVHPTQPLVLTSSDDMLIKLWNWEKMWACQRVFEGHT 142
            |.|||:|:..|...::.|.||||::|.:.||||.|.::::|||..|::|:||..|..::.|:.|.
 Worm    75 DQQIRIFDAETFSLINEFTAHSDFIRSLTVHPTLPYLISASDDRKIRVWDWENEWRMEQEFQEHA 139

  Fly   143 HYVMQIVFNPKDNNTFASASLDRTVKVWQLGSNFANFTLEGHEKGVNCVDYYHGGDKPYLISGAD 207
            ||:|||..||:|...|.|.|||:|:|||:||...:..||||||||||||::..||   .::||:|
 Worm   140 HYIMQIAVNPEDPEMFVSGSLDKTLKVWKLGEQESICTLEGHEKGVNCVEFLTGG---RIVSGSD 201

  Fly   208 DRLVKIWDYQNKTCVQTLE-GHAQNISAVCFHPELPIVLTGSEDGTVRIWHSGTYRLETCLNYGF 271
            |..:.:||.|.:.|::||: .|..|::.|.  |....:::|:||.||:||:|.|:.||..||:..
 Worm   202 DCSICVWDIQTQKCIETLKNAHKNNVTFVT--PFKTWIISGAEDSTVKIWNSQTFSLEKELNFEK 264

  Fly   272 ERVWTISSMRGTNNVALGYDEGSIIIKV 299
            .|.|.:::.: ::.:|:|:|.|::.:::
 Worm   265 GRAWCVAAGK-SDAIAVGFDSGAVTVEI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta'COPNP_524836.2 WD40 8..378 CDD:225201 127/288 (44%)
WD40 8..297 CDD:238121 127/284 (45%)
WD40 repeat 20..55 CDD:293791 15/34 (44%)
WD40 repeat 61..97 CDD:293791 18/35 (51%)
WD40 repeat 102..139 CDD:293791 14/36 (39%)
WD40 repeat 146..182 CDD:293791 18/35 (51%)
WD40 repeat 188..226 CDD:293791 15/37 (41%)
Coatomer_WDAD 321..765 CDD:281977
Y41C4A.32NP_499518.2 WD40 8..271 CDD:238121 123/265 (46%)
WD40 repeat 17..52 CDD:293791 15/34 (44%)
WD40 repeat 58..94 CDD:293791 18/35 (51%)
WD40 repeat 99..136 CDD:293791 14/36 (39%)
WD40 repeat 143..179 CDD:293791 18/35 (51%)
WD40 repeat 185..220 CDD:293791 15/37 (41%)
WD40 repeat 224..251 CDD:293791 10/28 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D122926at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19876
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.