DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d14 and CYP72C1

DIOPT Version :9

Sequence 1:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001319024.1 Gene:CYP72C1 / 838276 AraportID:AT1G17060 Length:313 Species:Arabidopsis thaliana


Alignment Length:279 Identity:57/279 - (20%)
Similarity:110/279 - (39%) Gaps:39/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYLELFAILLAT----ALAWDYMRKRRHNKMYAEAGIRGPKSYPLVGNAPLLINESPKSKSSIFD 61
            ::|..|.||:..    |:.|.::|.:|..|...:.|..|.....|:|:    :.||.:.......
plant    10 VFLIGFLILILNWVWRAVNWVWLRPKRLEKYLKKQGFSGNSYRILMGD----MRESNQMDQVAHS 70

  Fly    62 MQFRLIAEF---------------GKNIKTQMLGESGFMTADSKMIEAIMSSQQTIQKNNLYSLL 111
            :...|.|:|               ||...|........:..|.:.:..|||..:...|..:.|..
plant    71 LPLPLDADFLPRMMPFLHHTVLKHGKKCFTWYGPYPNVIVMDPETLREIMSKHELFPKPKIGSHN 135

  Fly   112 VNWLGDGLLISQGKKWFRRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDR---ADGKTVINM 173
            ..:| .|||..:|.||.:.|.|:.|||....|:..:..|:.....|::: ::|   |.|...::.
plant   136 HVFL-SGLLNHEGPKWSKHRSILNPAFRIDNLKSILPAFNSSCKEMLEE-WERLASAKGTMELDS 198

  Fly   174 FPVACLCAMDIIAETAM------GVKI----NAQLQPQFTYVQSV-TTASAMLAERFMNPLQRLD 227
            :........:::|..:.      |:||    ..|:......:::| ...|..|..:|...|:..:
plant   199 WTHCHDLTRNMLARASFGDSYKDGIKIFEIQQEQIDLGLLAIRAVYIPGSKFLPTKFNRRLRETE 263

  Fly   228 FTMKLFYPKLLDKLNDAVK 246
            ..|:..:..:::...:.:|
plant   264 RDMRAMFKAMIETKEEEIK 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 47/242 (19%)
CYP72C1NP_001319024.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I1543
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.