DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d14 and CYP94B3

DIOPT Version :10

Sequence 1:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_190421.1 Gene:CYP94B3 / 824011 AraportID:AT3G48520 Length:506 Species:Arabidopsis thaliana


Alignment Length:79 Identity:22/79 - (27%)
Similarity:41/79 - (51%) Gaps:8/79 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   962 VLELFDKKIRKDAAERRKLAVFVHGKNEDQEAVNTIIKKNAESGKKEK-EVLYSDQLRQFLPLYG 1025
            ||.|:|::.:....||.....||    |:::.::|   :...:|...| ::|||:.:|....||.
plant    71 VLALYDRQGQPIEIERTAFVDFV----ENEKELST---EKTNNGTHYKLQLLYSNGVRTEQDLYV 128

  Fly  1026 RPIAAIDLKPIGVD 1039
            |.|.::..:||..:
plant   129 RLIDSVTKQPIAYE 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d14NP_001259179.1 CYP4 71..503 CDD:410721
CYP94B3NP_190421.1 CYP86A 69..492 CDD:410687 22/79 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.