DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d14 and sad

DIOPT Version :9

Sequence 1:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_650123.1 Gene:sad / 44858 FlyBaseID:FBgn0003312 Length:520 Species:Drosophila melanogaster


Alignment Length:414 Identity:95/414 - (22%)
Similarity:171/414 - (41%) Gaps:66/414 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GLLISQGKKWFRRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDRADGKTVINMFPVACLCAM 182
            ||...:|.:|...|:|:...    :|...:...|....:..:::.|:...:|        ...|.
  Fly   148 GLFFMEGAEWLHNRRILNRL----LLNGNLNWMDVHIESCTRRMVDQWKRRT--------AEAAA 200

  Fly   183 DIIAETAMGVKINAQLQPQFTYVQSVTTASAMLAERFMNPLQRLDFTMKLFYPKL---LDKLNDA 244
            ..:||:.........|..|..|..|:.....::..           |..|..||:   ||.....
  Fly   201 IPLAESGEIRSYELPLLEQQLYRWSIEVLCCIMFG-----------TSVLTCPKIQSSLDYFTQI 254

  Fly   245 VKNMHDFTNSVITERRELLQ---------------KAIADGGDADAALLND---VGQKRRMALLD 291
            |..:.:.::.::|....|.|               :.:.:|    ||:::.   |.:.:|.. .|
  Fly   255 VHKVFEHSSRLMTFPPRLAQILRLPIWRDFEANVDEVLREG----AAIIDHCIRVQEDQRRP-HD 314

  Fly   292 VLLKSTIDGAPLSNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDK 356
            ..|...:..|.:..|.|:......:....|||..|..:..:.|::.|.:|.|:.:|         
  Fly   315 EALYHRLQAADVPGDMIKRIFVDLVIAAGDTTAFSSQWALFALSKEPRLQQRLAKE--------- 370

  Fly   357 SAPVTMKLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGKLIPADSNVIILIYHAQRDPD 421
                  :...:.:.:..:|||||||:|..|.||||:.||..|.|..|..|:.|::.:|.|.|||.
  Fly   371 ------RATNDSRLMHGLIKESLRLYPVAPFIGRYLPQDAQLGGHFIEKDTMVLLSLYTAGRDPS 429

  Fly   422 YFPDPEKFIPDRFSMERKGEI-SPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFELLPLGE 485
            :|..||:.:|:|:.:....:: ......||:.|.|:|||::.|:.::.|.:.:....||:..|.|
  Fly   430 HFEQPERVLPERWCIGETEQVHKSHGSLPFAIGQRSCIGRRVALKQLHSLLGRCAAQFEMSCLNE 494

  Fly   486 -EVQPVLNVILRSTTGINCGLKPR 508
             .|..||.::......:...|:||
  Fly   495 MPVDSVLRMVTVPDRTLRLALRPR 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 90/393 (23%)
sadNP_650123.1 p450 63..497 CDD:299894 89/391 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24291
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.