DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d14 and CYP4F3

DIOPT Version :9

Sequence 1:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_000887.2 Gene:CYP4F3 / 4051 HGNCID:2646 Length:520 Species:Homo sapiens


Alignment Length:405 Identity:156/405 - (38%)
Similarity:229/405 - (56%) Gaps:16/405 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YSLLVNWLGDGLLISQGKKWFRRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDRA-DGKTVI 171
            ||.|..|||||||:|.|:||.|.|:::||||||.||:.::::|::....|..|....| :|...:
Human   125 YSFLKPWLGDGLLLSAGEKWSRHRRMLTPAFHFNILKPYMKIFNESVNIMHAKWQLLASEGSARL 189

  Fly   172 NMFPVACLCAMDIIAETAMGVKINAQLQPQFTYVQSVTTASAMLAERFMNPLQRLDFTMKLFY-- 234
            :||....|..:|.:.:.......:.|.:|. .|:.::...||::.:|....|..:||   |:|  
Human   190 DMFEHISLMTLDSLQKCVFSFDSHCQEKPS-EYIAAILELSALVTKRHQQILLYIDF---LYYLT 250

  Fly   235 PKLLDKLNDAVKNMHDFTNSVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKS-TI 298
            |. ..:...|.:.:||||::||.|||..|.....|.      .|....:.:.:..:||||.| ..
Human   251 PD-GQRFRRACRLVHDFTDAVIQERRRTLPSQGVDD------FLQAKAKSKTLDFIDVLLLSKDE 308

  Fly   299 DGAPLSNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKSAPVTMK 363
            ||..||::|||.|.|||||||||||.|.:::..|.||:|||.|.|..|||::::.|.:...:...
Human   309 DGKKLSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQERCRQEVQELLKDREPKEIEWD 373

  Fly   364 LLGELKYLECVIKESLRLFPSVPIIGRYISQDTVL-DGKLIPADSNVIILIYHAQRDPDYFPDPE 427
            .|.:|.:|...|||||||.|.||.:.|..:||.|| ||::||.....:|.::....:|..:||||
Human   374 DLAQLPFLTMCIKESLRLHPPVPAVSRCCTQDIVLPDGRVIPKGIICLISVFGTHHNPAVWPDPE 438

  Fly   428 KFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFELLPLGEEVQPVLN 492
            .:.|.||..:...|.||.|:.||||||||||||.|||.|||..:...:..|.:||...|.:....
Human   439 VYDPFRFDPKNIKERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLGLTLLRFRVLPDHTEPRRKPE 503

  Fly   493 VILRSTTGINCGLKP 507
            ::||:..|:...::|
Human   504 LVLRAEGGLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 152/385 (39%)
CYP4F3NP_000887.2 p450 52..515 CDD:365848 155/400 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154790
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.