DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d14 and Cyp6a21

DIOPT Version :9

Sequence 1:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_611003.2 Gene:Cyp6a21 / 36665 FlyBaseID:FBgn0033981 Length:504 Species:Drosophila melanogaster


Alignment Length:425 Identity:89/425 - (20%)
Similarity:175/425 - (41%) Gaps:81/425 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LGDGLLISQGKKWFRRRKIITPAFH-----------FKILEDFVEVFDQQSATMVQKLYDRADGK 168
            |...|.:..|:||...|..::..|.           .|:..:|.:||.|..|.           .
  Fly   116 LSGQLFLLDGQKWRTMRNKLSSTFTSGKMKYMFPTVVKVANEFTDVFGQNVAK-----------S 169

  Fly   169 TVINMFPVACLCAMDIIAETAMGVKINAQLQPQFTY---------VQSVTTASAMLAERFMNPLQ 224
            .|:.:..:......|:|...|.|::.::...|...:         .|.:..........|.|..:
  Fly   170 PVVEVRELLARFTTDVIGTCAFGIECSSLKDPDAEFREMGRRSLTEQRLGPVGIGFVNSFPNLAR 234

  Fly   225 RLDFTM-----KLFYPKLLDKL------NDAVKNMHDFTNSVITERRELLQKAIADGGDADAALL 278
            ||...|     :.|:.:::.:.      |:..:|  ||.:.:|..:.:.|.  ::..|::     
  Fly   235 RLHMKMTAEPIERFFMRIVRETVAFREQNNIRRN--DFMDQLIDLKNKPLM--VSQSGES----- 290

  Fly   279 NDVGQKRRMALLDVLLKSTIDGAPLSNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQAR 343
                                  ..|:.::|..:...|...|.:|:::::.|..|.||::.::|.|
  Fly   291 ----------------------VNLTIEEIAAQAFVFFAAGFETSSTTMGFALYELAQNQDIQNR 333

  Fly   344 VFQEVRDVIGDDKSAPVTMKLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDGK---LIPA 405
            |.:|.::|| :..:..:..:.:.:|.||:.|:.|:|||:..:|::.|...:|..:.|.   :|..
  Fly   334 VRKECQEVI-EKCNGELNYESMKDLVYLDQVVSETLRLYTVLPVLNRECLEDYEVPGHPKYVIKK 397

  Fly   406 DSNVIILIYHAQRDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKST 470
            ...|:|......||...:.:|..|.||.||.||..|.....:.||..|||||||.:|..::.:..
  Fly   398 GMPVLIPCGAMHRDEKLYANPNTFNPDNFSPERVKERDSVEWLPFGDGPRNCIGMRFGQMQARIG 462

  Fly   471 ISKMVRHFELLPLGEEVQPVL----NVILRSTTGI 501
            ::.:::.|:.....:...|:.    ..::.|.:||
  Fly   463 LALLIKDFKFSVCEKTTIPMTYNKEMFLIASNSGI 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 85/407 (21%)
Cyp6a21NP_611003.2 p450 35..499 CDD:278495 89/425 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.