DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d14 and Cyp6t3

DIOPT Version :9

Sequence 1:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_610745.1 Gene:Cyp6t3 / 36318 FlyBaseID:FBgn0033697 Length:501 Species:Drosophila melanogaster


Alignment Length:516 Identity:116/516 - (22%)
Similarity:210/516 - (40%) Gaps:98/516 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFAILLATALAW-----DYMRKRRHNKMYAEAGI--RGPKSYPLVGNAPLLINESPKSKSSIFDM 62
            |..:.:.|...|     ||.|.|         ||  ..|.|:..:||...|:    ..:.|..|:
  Fly     6 LLLLTIVTLNFWLRHKYDYFRSR---------GIPHLPPSSWSPMGNLGQLL----FLRISFGDL 57

  Fly    63 QFRLIAEFGKNIKTQMLG-----ESGFMTADSKMIEAIMSSQQTIQKNNLYSLLVNWL-----GD 117
             ||.:....:|.:.:::|     ....|..|.::|      :|.:.||  ::..:|..     ||
  Fly    58 -FRQLYADPRNGQAKIVGFFIFQTPALMVRDPELI------RQVLIKN--FNNFLNRFESADAGD 113

  Fly   118 --GLL---ISQGKKWFRRRKIITPAFHFKILED--FVEVFDQQSATMVQKLYDRADGKTVINMFP 175
              |.|   :::...|...|:.::..|....:.|  :.::.|  .|:.:::..:|..|..:..:.|
  Fly   114 PMGALTLPLAKYHHWKESRQCMSQLFTSGRMRDVMYSQMLD--VASDLEQYLNRKLGDRLERVLP 176

  Fly   176 VACLCAM---DIIAETAMGVKINAQLQPQFTYVQSVTTASAMLAERF-MNPLQRLDFTMKLFYPK 236
            :..:|.:   |:.......:.:....:.:...:...       .|.| .||.:.|||....|.||
  Fly   177 LGRMCQLYTTDVTGNLFYSLNVGGLRRGRSELITKT-------KELFNTNPRKVLDFMSVFFLPK 234

  Fly   237 LLDKLNDAVKNMHDFTNSVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTIDGA 301
            ....|...|     ||.......|.               |::|..:..:..|::.|....:..:
  Fly   235 WTGVLKPKV-----FTEDYARYMRH---------------LVDDHHEPTKGDLINQLQHFQLSRS 279

  Fly   302 PLSN------DDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKSAPV 360
              ||      |.:..:....:..|.:|:::.:.||.|.||:.|::|.|:..|:|:..  ..:|.:
  Fly   280 --SNHYSQHPDFVASQAGIILLAGFETSSALMGFTLYELAKAPDIQERLRSELREAF--ISTATL 340

  Fly   361 TMKLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVLDG--------KLIPADSNVIILIYHAQ 417
            :...|..|.||:.|..|:|||:|:...:.|..: .:..:|        .::|......|.|....
  Fly   341 SYDTLMTLPYLKMVCLEALRLYPAAAFVNRECT-SSASEGFSLQPHVDFIVPPGMPAYISILGLH 404

  Fly   418 RDPDYFPDPEKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHF 478
            ||..::|:|..|.|:||..||...|.|..|.||.|||..|||.:..:|::|..|..:::.:
  Fly   405 RDERFWPEPCVFDPERFGPERSRHIHPMTYIPFGAGPHGCIGSRLGVLQLKLGIVHILKQY 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 107/480 (22%)
Cyp6t3NP_610745.1 p450 34..486 CDD:299894 107/479 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.