DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d14 and Cyp4f18

DIOPT Version :9

Sequence 1:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001028858.2 Gene:Cyp4f18 / 290623 RGDID:1305261 Length:524 Species:Rattus norvegicus


Alignment Length:406 Identity:158/406 - (38%)
Similarity:228/406 - (56%) Gaps:18/406 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 YSLLVNWLGDGLLISQGKKWFRRRKIITPAFHFKILEDFVEVFDQQSATMVQKLYDR--ADGKTV 170
            |..|..|||||||:|.|.||.|.|.::||||||.||:.:|::|:..:..|..| :.|  :.|...
  Rat   125 YRFLKPWLGDGLLLSTGDKWSRHRHMLTPAFHFNILKPYVKIFNDSTNIMHAK-WQRLASQGSAR 188

  Fly   171 INMFPVACLCAMDIIAETAMGVKINAQLQPQFTYVQSVTTASAMLAERFMNPLQRLDFTMKLFYP 235
            ::||....|..:|.:.:.......|.|.:|. .|:.::...||::|.|..:.|..:|    |||.
  Rat   189 LDMFEHISLMTLDSLQKCVFSFDSNCQEKPS-EYITAILELSALVARRHQSLLLYVD----LFYH 248

  Fly   236 KLLD--KLNDAVKNMHDFTNSVITERRELLQKAIADGGDADAALLNDVGQKRRMALLDVLLKSTI 298
            ...|  :...|.:.:||||::||.|||    :.:.|.|..||  |....:.:.:..:||||.|..
  Rat   249 LTRDGMRFRKACRLVHDFTDAVIRERR----RTLPDQGGDDA--LKAKAKAKTLDFIDVLLLSKD 307

  Fly   299 D-GAPLSNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKSAPVTM 362
            : |..||::|||.|.|||||.|||||.|.:::..|.||:|||.|.|..||||:::.|.:...:..
  Rat   308 EHGEALSDEDIRAEADTFMFGGHDTTASGLSWILYNLAKHPEYQERCRQEVRELLRDREPEEIEW 372

  Fly   363 KLLGELKYLECVIKESLRLFPSVPIIGRYISQDTVL-DGKLIPADSNVIILIYHAQRDPDYFPDP 426
            ..|.:|.:|...|||||||.|....|.|..:||.:| ||::||......|.|:....:|..:|||
  Rat   373 DDLAQLPFLTMCIKESLRLHPPATAISRCCTQDIMLPDGRVIPKGVICRISIFGTHHNPAVWPDP 437

  Fly   427 EKFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFELLPLGEEVQPVL 491
            |.:.|.||..:.....||.|:.||||||||||||.|||.|||..::..:..|.:||..:|.:...
  Rat   438 EVYNPFRFDADNGEGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRVLPDDKEPRRKP 502

  Fly   492 NVILRSTTGINCGLKP 507
            .:|||:..|:...::|
  Rat   503 ELILRAEGGLWLRVEP 518

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 153/386 (40%)
Cyp4f18NP_001028858.2 CYP4F 74..515 CDD:410772 157/401 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348654
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3B9GY
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.