DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cyp4d14 and CYP4X1

DIOPT Version :9

Sequence 1:NP_001259179.1 Gene:Cyp4d14 / 45706 FlyBaseID:FBgn0023541 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_828847.1 Gene:CYP4X1 / 260293 HGNCID:20244 Length:509 Species:Homo sapiens


Alignment Length:407 Identity:139/407 - (34%)
Similarity:215/407 - (52%) Gaps:38/407 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 LGDGLLISQGKKWFRRRKIITPAFHFKILEDFVEVFDQQSATMV---QKLYDRADGKTVINMFPV 176
            ||.||....|.|||:.|:::||.|||.||:.::||.......|:   :|:....|  |.:.::..
Human   121 LGKGLAALDGPKWFQHRRLLTPGFHFNILKAYIEVMAHSVKMMLDKWEKICSTQD--TSVEVYEH 183

  Fly   177 ACLCAMDIIAETAMGVKINAQLQPQF-TYVQSVTTASAMLAERFMNPLQRLDFTMKLF-----YP 235
            ....::|||.:.|...:.|.|..... .|.:::...|.::..|..:.|...|...||.     :.
Human   184 INSMSLDIIMKCAFSKETNCQTNSTHDPYAKAIFELSKIIFHRLYSLLYHSDIIFKLSPQGYRFQ 248

  Fly   236 KLLDKLNDAVKNMHDFTNSVITERRELLQKAIADGGDADAALLNDVGQKRR-MALLDVLLKSTID 299
            ||...||       .:|:::|.||::.||          |.:..|...||: ...||::|.:..:
Human   249 KLSRVLN-------QYTDTIIQERKKSLQ----------AGVKQDNTPKRKYQDFLDIVLSAKDE 296

  Fly   300 -GAPLSNDDIREEVDTFMFEGHDTTTSSIAFTCYLLARHPEVQARVFQEVRDVIGDDKSAPVTMK 363
             |:..|:.|:..||.||:..||||..:||::..|.||.:||.|.|..:|||.::||..|  :|..
Human   297 SGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNPEHQERCREEVRGILGDGSS--ITWD 359

  Fly   364 LLGELKYLECVIKESLRLFPSVPIIGRYISQD-TVLDGKLIPADSNVIILIYHAQRDPDYFPDPE 427
            .|||:.|....|||:.||.|:||.|.|.:|:. |..||..:||...|::.|:....:|..:.:|:
Human   360 QLGEMSYTTMCIKETCRLIPAVPSISRDLSKPLTFPDGCTLPAGITVVLSIWGLHHNPAVWKNPK 424

  Fly   428 KFIPDRFSMERKGEISPFAYTPFSAGPRNCIGQKFAMLEMKSTISKMVRHFELLPLGEEVQPVL- 491
            .|.|.|||.|...:..|:||.|||||.||||||:|||:|:|.||:.::.||.:.|  :..:|:. 
Human   425 VFDPLRFSQENSDQRHPYAYLPFSAGSRNCIGQEFAMIELKVTIALILLHFRVTP--DPTRPLTF 487

  Fly   492 --NVILRSTTGINCGLK 506
              :.||:...|:...||
Human   488 PNHFILKPKNGMYLHLK 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cyp4d14NP_001259179.1 p450 34..489 CDD:278495 133/385 (35%)
CYP4X1NP_828847.1 p450 47..501 CDD:306555 137/402 (34%)
heme binding region 447..460 10/12 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154714
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1247045at2759
OrthoFinder 1 1.000 - - FOG0000016
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X23
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.