DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3h and Rpn11

DIOPT Version :9

Sequence 1:NP_524834.2 Gene:eIF3h / 45682 FlyBaseID:FBgn0022023 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_608905.1 Gene:Rpn11 / 33738 FlyBaseID:FBgn0028694 Length:308 Species:Drosophila melanogaster


Alignment Length:286 Identity:69/286 - (24%)
Similarity:123/286 - (43%) Gaps:46/286 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 NTINYVQCDGLAVMKMVKHCHEESSNMDLAQGALLG-LVVDKCLEITNCFPFPKSGD----ETMD 76
            :|...|....||::||:|| ......|:: .|.:|| .|.|..:::.:.|..|::|.    |.:|
  Fly    24 DTAEQVYISSLALLKMLKH-GRAGVPMEV-MGLMLGEFVDDYTVQVIDVFAMPQTGTGVSVEAVD 86

  Fly    77 EEMYQLTVMRRLRRVNVDHLHVGWYQS-SDVGNSLSMALLESQYHYQTSIEESVVVVYDTQKSSR 140
             .::|..::..|::.....:.||||.| ...|..||...:.:|..::...|.:|.||.|..:|.:
  Fly    87 -PVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVK 150

  Fly   141 GFLCLKAYRL-TPQAIQMYKD--------GDFTPEAFRTLKVGYENLFAEIPIVIKNSPLTNIM- 195
            |.:.:.|:|| .|..:.:.::        |.....:.:.|..|....:..|.|..:.:.|...| 
  Fly   151 GKVVIDAFRLINPNMLVLGQEPRQTTSNLGHLQKPSVQALIHGLNRHYYSISINYRKNELEQKML 215

  Fly   196 -------------MSELNE--LLPEDKGHNFLDLGTATVLENQMRSLIERVDELYQEAVRYNKYQ 245
                         :|:.||  .:.||.....|||.     :|..:|| |..:::..|.:....  
  Fly   216 LNLHKKSWKDGLTLSDYNEHCSINEDTVAEMLDLA-----KNYNKSL-EDEEKMTPEQLAIKN-- 272

  Fly   246 QVVFKQDTEKH--RALAKLAAENAVR 269
              |.|||.::|  ..:.|:...|.|:
  Fly   273 --VGKQDPKRHLEEKVDKVMQNNIVQ 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3hNP_524834.2 MPN_eIF3h 20..281 CDD:163696 68/283 (24%)
Rpn11NP_608905.1 MPN_RPN11_CSN5 19..284 CDD:163700 66/272 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438614
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10410
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.