DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tapdelta and ssr4

DIOPT Version :9

Sequence 1:NP_001286315.1 Gene:Tapdelta / 45680 FlyBaseID:FBgn0021795 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001002082.1 Gene:ssr4 / 326701 ZFINID:ZDB-GENE-030131-4900 Length:168 Species:Danio rerio


Alignment Length:165 Identity:66/165 - (40%)
Similarity:101/165 - (61%) Gaps:7/165 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFAICLIAAVCASGVYGSCKATVSSFSTQDATILTQLAHVGEFTLQC-SGAAPASLFAEFPCGKV 68
            |.|:||  :.||:........:.||::|.||.|.::...:.|.:|.| :||...:|:|:.. ||.
Zfish     8 LLALCL--SFCAAETCTDPVISPSSYTTTDALISSETVFIVELSLACANGAQSVALYADVN-GKQ 69

  Fly    69 VPVAKVGD-NKYQVSWVEDIKQGSSGNVQVRLFDEDGYANVRKAQRDGDKVSSVKSLLDISVPTK 132
            .||.:..| .||||||....||.|||..||:.|||:.|:.:|||||:.:.|.::|.|..::|..:
Zfish    70 FPVTRGQDVGKYQVSWSVPHKQASSGTYQVKFFDEESYSTLRKAQRNNEDVDAIKPLFSVNVDHR 134

  Fly   133 GAYKGPWIKAELLAAFLVGGFAYF-AFTTKGKVQS 166
            ||:.|||:..|:||| |:|...|: |::||..:|:
Zfish   135 GAWNGPWVSTEVLAA-LIGIMVYYLAYSTKSAIQA 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TapdeltaNP_001286315.1 TRAP-delta 5..165 CDD:283143 65/162 (40%)
ssr4NP_001002082.1 TRAP-delta 7..167 CDD:283143 65/162 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170573895
Domainoid 1 1.000 111 1.000 Domainoid score I6219
eggNOG 1 0.900 - - E1_KOG4088
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4573
Inparanoid 1 1.050 113 1.000 Inparanoid score I4835
OMA 1 1.010 - - QHG48046
OrthoDB 1 1.010 - - D1518302at2759
OrthoFinder 1 1.000 - - FOG0008190
OrthoInspector 1 1.000 - - oto38827
orthoMCL 1 0.900 - - OOG6_106759
Panther 1 1.100 - - LDO PTHR12731
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4369
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.