DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tapdelta and Ssr4

DIOPT Version :9

Sequence 1:NP_001286315.1 Gene:Tapdelta / 45680 FlyBaseID:FBgn0021795 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_058895.1 Gene:Ssr4 / 29435 RGDID:62034 Length:173 Species:Rattus norvegicus


Alignment Length:167 Identity:58/167 - (34%)
Similarity:90/167 - (53%) Gaps:14/167 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IAAVCASGVYGSC---------KATVSSFSTQDATILTQLAHVGEFTLQCSGAAP-ASLFAEFPC 65
            :|.:..||:  ||         :.|.|.::|.||.|.|:...:.|.:|.|..... .:|:|:. .
  Rat    10 LALLLLSGL--SCCSAEACLEPQITPSYYTTSDAVISTETVFIVEISLTCKNRVQNMALYADV-S 71

  Fly    66 GKVVPVAKVGD-NKYQVSWVEDIKQGSSGNVQVRLFDEDGYANVRKAQRDGDKVSSVKSLLDISV 129
            ||..||.:..| .:|||||..:.|...:|..:||.|||:.|:.:|||||:.:.||.:..|..:||
  Rat    72 GKQFPVTRGQDVGRYQVSWSLEHKSAHAGTYEVRFFDEESYSLLRKAQRNNEDVSIIPPLFTVSV 136

  Fly   130 PTKGAYKGPWIKAELLAAFLVGGFAYFAFTTKGKVQS 166
            ..:|.:.|||:..|:|||.:.....|.||:.|..:|:
  Rat   137 DHRGTWNGPWVSTEVLAAAIGIVIYYLAFSAKSHIQA 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TapdeltaNP_001286315.1 TRAP-delta 5..165 CDD:283143 57/164 (35%)
Ssr4NP_058895.1 TRAP-delta 22..172 CDD:398850 52/150 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334688
Domainoid 1 1.000 95 1.000 Domainoid score I7254
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H4573
Inparanoid 1 1.050 95 1.000 Inparanoid score I4971
OMA 1 1.010 - - QHG48046
OrthoDB 1 1.010 - - D1518302at2759
OrthoFinder 1 1.000 - - FOG0008190
OrthoInspector 1 1.000 - - oto97077
orthoMCL 1 0.900 - - OOG6_106759
Panther 1 1.100 - - LDO PTHR12731
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.