DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tapdelta and ssr4

DIOPT Version :9

Sequence 1:NP_001286315.1 Gene:Tapdelta / 45680 FlyBaseID:FBgn0021795 Length:166 Species:Drosophila melanogaster
Sequence 2:XP_002937920.2 Gene:ssr4 / 100170417 XenbaseID:XB-GENE-968231 Length:170 Species:Xenopus tropicalis


Alignment Length:168 Identity:61/168 - (36%)
Similarity:100/168 - (59%) Gaps:11/168 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LFAICLIAAVCASGVYGSCKATV---SSFSTQDATILTQLAHVGEFTLQC-SGAAPASLFAEFPC 65
            |.|:.|..|.|::   .:|...|   |.::|.||.|.:::..:.|.:|.| :||...:|:|:.. 
 Frog     8 LLAVLLALAACSA---ETCTEPVIVPSYYTTSDAVISSEVVFIVEISLSCTNGAQNVALYADVN- 68

  Fly    66 GKVVPVAKVGD-NKYQVSWVEDIKQGSSGNVQVRLFDEDGYANVRKAQRDGDKVSSVKSLLDISV 129
            ||..||.:..| .:|||||..:.|...||..:|:.|||:.|:.:|||||:.:.:||::.|..::|
 Frog    69 GKQFPVTRGQDVGRYQVSWSLEHKNARSGTYEVKFFDEESYSLLRKAQRNNEDISSIQPLFTVNV 133

  Fly   130 PTKGAYKGPWIKAELLAAFLVGGFAYF-AFTTKGKVQS 166
            ..:||:.|||:..|:||. |:|...|: |:|.|..:|:
 Frog   134 DHRGAWNGPWVSTEVLAG-LIGILVYYTAYTAKSSIQA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TapdeltaNP_001286315.1 TRAP-delta 5..165 CDD:283143 60/165 (36%)
ssr4XP_002937920.2 TRAP-delta 18..169 CDD:368425 56/155 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I7030
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H4573
Inparanoid 1 1.050 99 1.000 Inparanoid score I4870
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1518302at2759
OrthoFinder 1 1.000 - - FOG0008190
OrthoInspector 1 1.000 - - oto103769
Panther 1 1.100 - - LDO PTHR12731
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.