DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dom and CHR1

DIOPT Version :10

Sequence 1:NP_001286676.1 Gene:dom / 45655 FlyBaseID:FBgn0020306 Length:3233 Species:Drosophila melanogaster
Sequence 2:NP_201476.1 Gene:CHR1 / 836808 AraportID:AT5G66750 Length:764 Species:Arabidopsis thaliana


Alignment Length:72 Identity:16/72 - (22%)
Similarity:25/72 - (34%) Gaps:35/72 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 AGLLKLDLYRNSLKYYLEFGTWCDHVLCLYLKKIYRKVNVTMDPFREAPLVVPGKEPTPPPEQES 190
            |.|.|||.           |:|       ||:|         |||:...::.        |:.:.
plant   328 ANLQKLDA-----------GSW-------YLEK---------DPFKTVSVLT--------PQDQE 357

  Fly   191 EVEEDEV 197
            ||...::
plant   358 EVRRQKI 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
domNP_001286676.1 HSA 543..614 CDD:214727
HepA 692..>1235 CDD:440319
DEXQc_SRCAP 949..1171 CDD:350761
SF2_C_SNF 1685..1817 CDD:350180
DISARM_DrmD_b <1702..>1936 CDD:468472
HEC1 <1858..>2031 CDD:444066
SP1-4_N 2486..>2819 CDD:425404
CHR1NP_201476.1 PLN03142 12..>739 CDD:215601 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.