DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and dbpa

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001183989.1 Gene:dbpa / 565056 ZFINID:ZDB-GENE-060503-802 Length:366 Species:Danio rerio


Alignment Length:262 Identity:107/262 - (40%)
Similarity:133/262 - (50%) Gaps:57/262 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   440 QTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENN---IPDG---------------------- 479
            |:|||||.||::|||.|..|...||.||:|||:||.   :|.|                      
Zfish   100 QSAFLGPLLWERTLPCDGGLFQLQYMDLEEFLTENGMGCMPSGNTCSTAAQVPSQSTQSAVPSQS 164

  Fly   480 --LPGTHLGHSSGLGHRSDSLGHAAGLS--LGL----------------GHITTKRERSPSPSDC 524
              .|.:.....|.......||..::..|  |||                |..|...:.|.||| |
Zfish   165 SQCPPSSSPPCSSSASSISSLSSSSSSSSLLGLDVPQGPGLLGGPECLHGAQTVPPDPSQSPS-C 228

  Fly   525 ISPDTLNP-----------PSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDE 578
            ..|..:.|           |.||:...|.......||||...||:|||||||||||:||..||||
Zfish   229 PPPPVVPPTNAADVMVNFDPDPADLALSSVPGQEAFDPRRHRFSEEELKPQPMIKKARKMLVPDE 293

  Fly   579 LKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLSK 643
            .||||||.||.||:.||||||||||.|||||::||.:||:|||.|.|||..:::|....|..::|
Zfish   294 QKDDKYWCRRLKNDEAAKRSRDARRLKENQISVRAAFLERENAALRQEVADMRKELGRCRNIINK 358

  Fly   644 FQ 645
            ::
Zfish   359 YE 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 37/58 (64%)
coiled coil 581..639 CDD:269843 36/57 (63%)
dbpaNP_001183989.1 bZIP_HLF 295..354 CDD:269843 37/58 (64%)
coiled coil 296..354 CDD:269843 36/57 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586460
Domainoid 1 1.000 87 1.000 Domainoid score I7946
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1023460at2759
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm24802
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X901
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.