DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and hlfb

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_005156391.1 Gene:hlfb / 557886 ZFINID:ZDB-GENE-110420-3 Length:300 Species:Danio rerio


Alignment Length:265 Identity:118/265 - (44%)
Similarity:144/265 - (54%) Gaps:58/265 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 DKYK---EEGDIWNVEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIPDGLPGTH--- 484
            ||.|   |||:    ..|:|||||.||||||.||.|....:|.||:||||||.||.. |..|   
Zfish    43 DKVKKLDEEGN----PPQSAFLGPTLWDKTLSYDGDSFQLEYMDLEEFLSENGIPSS-PAQHDQN 102

  Fly   485 ------------------------LGHSSGLGHRSDSLG---------HAAGLSLGLGHITTKRE 516
                                    .|..|.:...|.|:.         |:.|.|     :.....
Zfish   103 LHQHHHQQQQQQQHQQQQQQVSMPQGPISVMDLSSRSIHTAISPQNCLHSPGRS-----VLPPSR 162

  Fly   517 RSPSPSDCISPDTLN-----PPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVP 576
            .:|||.|   |:.|:     .|.||:...|.......||||.|.||:|||||||||||:||.|:|
Zfish   163 NTPSPVD---PEALHIPVSYEPDPADLALSSVPGQEVFDPRKRKFSEEELKPQPMIKKARKIFIP 224

  Fly   577 DELK-DDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRAR 640
            |:|| |:||||||||||:||||||||||.||||||:||.:|||||..|.|||..|::|....:..
Zfish   225 DDLKQDEKYWARRRKNNVAAKRSRDARRLKENQIAIRAGFLEKENMALRQEVADLRKELGRCKNI 289

  Fly   641 LSKFQ 645
            |:|::
Zfish   290 LTKYE 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 41/59 (69%)
coiled coil 581..639 CDD:269843 40/57 (70%)
hlfbXP_005156391.1 bZIP_HLF 230..288 CDD:269843 40/57 (70%)
coiled coil 230..288 CDD:269843 40/57 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586465
Domainoid 1 1.000 87 1.000 Domainoid score I7946
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1023460at2759
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm24802
orthoMCL 1 0.900 - - OOG6_107038
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X901
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.