DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and cebpg

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001016443.1 Gene:cebpg / 549197 XenbaseID:XB-GENE-919758 Length:137 Species:Xenopus tropicalis


Alignment Length:121 Identity:35/121 - (28%)
Similarity:51/121 - (42%) Gaps:19/121 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   533 PSPAESTFSFASSGRDFDPRTRAFSDEELKP------QPMIKKSRKQFVPDELKDDKYWARRRKN 591
            ||.|....|.|..|....|:.     ..|.|      .|..|.|:|....|. ..::|..||.:|
 Frog     5 PSTASEGLSDALPGSPATPQL-----VPLNPGGGGKATPPSKNSKKGQRLDR-GSEEYRLRRERN 63

  Fly   592 NIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLSKFQDV 647
            |:|.|:||...:||......|...|::||..|..:::.|.:|       ||..:|:
 Frog    64 NMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAKIKLLTKE-------LSVLKDL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 18/58 (31%)
coiled coil 581..639 CDD:269843 18/57 (32%)
cebpgNP_001016443.1 bZIP_CEBPG 53..111 CDD:269861 20/64 (31%)
coiled coil 53..111 CDD:269861 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.