DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and nfil3

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001004120.1 Gene:nfil3 / 445509 ZFINID:ZDB-GENE-040822-28 Length:462 Species:Danio rerio


Alignment Length:89 Identity:36/89 - (40%)
Similarity:50/89 - (56%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   543 ASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKEN 607
            |..|.|.|......|....|.:....:.:::|:|||.||:.||.||||||.||||||:.||..:.
Zfish    25 ALQGTDRDLINHKLSTLPFKSKSTSCRRKREFIPDEKKDNLYWERRRKNNEAAKRSREKRRLNDM 89

  Fly   608 QIAMRARYLEKENATLHQEVEQLK 631
            .:..:...|.:|||:|..|:..||
Zfish    90 VLENKLMALGEENASLKAELLSLK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 26/52 (50%)
coiled coil 581..639 CDD:269843 25/51 (49%)
nfil3NP_001004120.1 bZIP_NFIL3 62..121 CDD:269842 26/52 (50%)
coiled coil 63..121 CDD:269842 25/51 (49%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 69..85 12/15 (80%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 91..112 6/20 (30%)
Vert_IL3-reg_TF 120..452 CDD:284047
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..210
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..289
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.