DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and CG7786

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_611101.1 Gene:CG7786 / 36802 FlyBaseID:FBgn0034096 Length:192 Species:Drosophila melanogaster


Alignment Length:213 Identity:60/213 - (28%)
Similarity:87/213 - (40%) Gaps:73/213 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   456 DADLKVTQYADLD-EFLSENN------IPDGLPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITT 513
            |....|:.:::|| |..|:||      ||..|..|.||..                    |.|..
  Fly    11 DVTETVSMHSELDAELESKNNPSYSISIPQNLRLTGLGFP--------------------GMIGA 55

  Fly   514 KRERSPSPSDCISPDTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSR------- 571
            ||.....|:.    :.:.|||.|.....|                      |:::.:|       
  Fly    56 KRSSETLPAF----EYIAPPSHALQALEF----------------------PLMELNRVGVIGGG 94

  Fly   572 -------------KQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATL 623
                         |:.:|:..||.||:.||::||.|||||||||:.:|::||.||..||:||:.|
  Fly    95 MFPGFVHRRVRGEKRPIPEAQKDAKYFERRKRNNEAAKRSRDARKIREDRIAFRAALLEQENSIL 159

  Fly   624 HQEVEQLKQENMDLRARL 641
            ..:|..|:.|...:|..|
  Fly   160 RAQVLALRDELQTVRQLL 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 30/58 (52%)
coiled coil 581..639 CDD:269843 29/57 (51%)
CG7786NP_611101.1 bZIP_HLF 116..175 CDD:269843 30/58 (52%)
coiled coil 117..175 CDD:269843 29/57 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.