DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and nfil3-5

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001183987.1 Gene:nfil3-5 / 335737 ZFINID:ZDB-GENE-030131-7677 Length:597 Species:Danio rerio


Alignment Length:114 Identity:42/114 - (36%)
Similarity:58/114 - (50%) Gaps:6/114 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   523 DCISPDTLNPPSPAESTFSFASSGRDFDPRTRAFSDEE----LKPQPMIKKSRK-QFVPDELKDD 582
            :.|:..|.|..|..|:..:|::..... |..:..|...    :||:|.....|| :|:.||.||.
Zfish     2 ESINLPTQNSGSSLETLETFSNYNESL-PSPQMSSPPRQGRLIKPKPNSSCRRKREFISDEKKDA 65

  Fly   583 KYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLK 631
            .||.:|||||.||||||:.||..:..:..|...|..||..|..|:.|||
Zfish    66 SYWEKRRKNNEAAKRSREKRRLNDMVLENRVIALNDENVRLKTELLQLK 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 26/52 (50%)
coiled coil 581..639 CDD:269843 25/51 (49%)
nfil3-5NP_001183987.1 bZIP_NFIL3 63..122 CDD:269842 26/52 (50%)
coiled coil 64..122 CDD:269842 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.