DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and HLF

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_005257326.1 Gene:HLF / 3131 HGNCID:4977 Length:296 Species:Homo sapiens


Alignment Length:250 Identity:120/250 - (48%)
Similarity:144/250 - (57%) Gaps:34/250 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 DKYKEEGDIWN--VEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIPDGLPG--THLG 486
            ||.|:..|..|  ...|:|||||.|||||||||.|....:|.||:||||||.||.. |.  .|..
Human    45 DKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPS-PSQHDHSP 108

  Fly   487 HSSGLGHRSDSLGHAAGLS--------------------LGLGHITTKRERSPSPSDCISPDTLN 531
            |..||...|.:......||                    :..|.:......:|||   |.|||:.
Human   109 HPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSP---IDPDTIQ 170

  Fly   532 -----PPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELK-DDKYWARRRK 590
                 .|.||:...|.......||||.|.||:|||||||||||:||.|:||:|| ||||||||||
Human   171 VPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKQDDKYWARRRK 235

  Fly   591 NNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLSKFQ 645
            ||:||||||||||.||||||:||.:|||||:.|.|||..|::|....:..|:|::
Human   236 NNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 42/59 (71%)
coiled coil 581..639 CDD:269843 41/57 (72%)
HLFXP_005257326.1 bZIP_HLF 226..284 CDD:269843 41/57 (72%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151880
Domainoid 1 1.000 89 1.000 Domainoid score I7864
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31074
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1023460at2759
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm40600
orthoMCL 1 0.900 - - OOG6_107038
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X901
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.710

Return to query results.
Submit another query.