DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and tefa

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_005156192.1 Gene:tefa / 30674 ZFINID:ZDB-GENE-990415-264 Length:306 Species:Danio rerio


Alignment Length:246 Identity:96/246 - (39%)
Similarity:132/246 - (53%) Gaps:37/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   425 DDKYKEEGDIWNVEA-------QTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIPDGLPG 482
            ||:..:|....:||:       .:|.|.|.:|:||:|||.|....:|.||:|||.||.|......
Zfish    37 DDENDKEKLFESVESGGVSEMGPSAALTPAIWEKTIPYDGDTFHLEYMDLEEFLMENGIAAAENE 101

  Fly   483 THLGHSSGLGHRSDSLGHAAGLSLG-----------------LGHITTKRERS---PSPSDCISP 527
            ........:...::....|:.:...                 :..|||....|   .|..:.::|
Zfish   102 QKSSEKENIQLTAEEPSTASAVKTAPAVTLLPVMALDPCEEEVVTITTSSSSSADNKSEENRMTP 166

  Fly   528 DTLNP----------PSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDD 582
            |.:||          |.|.:...|....|..||||...||:|||||||||||::|.|||::.|||
Zfish   167 DPINPDEIEVDVNFEPDPTDLVLSSIPGGELFDPRKHRFSEEELKPQPMIKKAKKVFVPEDQKDD 231

  Fly   583 KYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQE 633
            |||.||:|||:||||||||||.|||||.:||.:||:||:.|.|||.:|:::
Zfish   232 KYWQRRKKNNVAAKRSRDARRLKENQITVRAAFLERENSALRQEVAELRKD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 37/54 (69%)
coiled coil 581..639 CDD:269843 36/53 (68%)
tefaXP_005156192.1 bZIP_HLF 229..288 CDD:269843 37/54 (69%)
coiled coil 230..288 CDD:269843 36/53 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586470
Domainoid 1 1.000 87 1.000 Domainoid score I7946
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1023460at2759
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm24802
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X901
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.810

Return to query results.
Submit another query.