DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and Cebpd

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_037286.1 Gene:Cebpd / 25695 RGDID:2328 Length:268 Species:Rattus norvegicus


Alignment Length:223 Identity:62/223 - (27%)
Similarity:92/223 - (41%) Gaps:39/223 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   445 GPNLWD-----KTLP--YDADLKVTQYADLDEFLSENNIPDGLPGTHLGHSSGLGHRSDSLGHAA 502
            ||...|     .|.|  ||.:..:...|.:|...:       :|...|.|........:|...||
  Rat    36 GPEPGDLGEPGSTTPAMYDDESAIDFSAYIDSMAA-------VPTLELCHDEIFADLFNSNHKAA 93

  Fly   503 G---LSL---------GLGHIT---TKRERSPSPSDCISPDTLNPPSP---AESTFSFASSGRDF 549
            |   |.|         |:|.|.   .|||  |...|..:|.:|.|...   |::..|.|::.:..
  Rat    94 GAGSLELLQGGPTRPPGVGSIARGPLKRE--PDWGDGDAPGSLLPAQVAVCAQTVVSLAAAAQPT 156

  Fly   550 DPRT----RAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIA 610
            .|.:    |......|.|.|:.:|...:..||. ...:|..||.:||||.::|||..:::..::.
  Rat   157 PPTSPEPPRGSPGPSLAPGPVREKGAGKRGPDR-GSPEYRQRRERNNIAVRKSRDKAKRRNQEMQ 220

  Fly   611 MRARYLEKENATLHQEVEQLKQENMDLR 638
            .:...|..||..|||.||||.::...||
  Rat   221 QKLVELSAENEKLHQRVEQLTRDLASLR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 22/59 (37%)
coiled coil 581..639 CDD:269843 22/58 (38%)
CebpdNP_037286.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 4/13 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 98..132 10/35 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..223 18/71 (25%)
bZIP_CEBPD 188..252 CDD:269862 23/62 (37%)
coiled coil 191..249 CDD:269862 22/58 (38%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 9/26 (35%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 12/23 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.