DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Pdp1 and Cebpg

DIOPT Version :9

Sequence 1:	NP_729301.1	Gene:	Pdp1 / 45588	FlyBaseID:	FBgn0016694	Length:	647	Species:	Drosophila melanogaster
Sequence 2:	NP_036963.1	Gene:	Cebpg / 25301	RGDID:	2330	Length:	150	Species:	Rattus norvegicus

Alignment Length:	86	Identity:	28/86 - (32%)
Similarity:	44/86 - (51%)	Gaps:	8/86 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly   562 KPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQE 626
            |..|..|:|:|. .|.:...|:|..||.:||:|.|:||...:||......|...|::||..|..:
  Rat    44 KAVPPSKQSKKS-SPMDRNSDEYRQRRERNNMAVKKSRLKSKQKAQDTLQRVNQLKEENERLEAK 107

  Fly   627 VEQLKQENMDLRARLSKFQDV 647
            ::.|.:|       ||..:|:
  Rat   108 IKLLTKE-------LSVLKDL 121

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Pdp1	NP_729301.1	bZIP_HLF	580..639	CDD:269843	19/58 (33%)
Pdp1	NP_729301.1	coiled coil	581..639	CDD:269843	19/57 (33%)
Cebpg	NP_036963.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	27..94		18/50 (36%)
		bZIP_CEBPG	60..120	CDD:269861	21/66 (32%)
		coiled coil	65..116	CDD:269861	18/57 (32%)
		Basic motif. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	66..93		10/26 (38%)
		Leucine-zipper. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00978	97..118		8/27 (30%)

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG3119
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810