DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and Dbp

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_036675.1 Gene:Dbp / 24309 RGDID:2491 Length:325 Species:Rattus norvegicus


Alignment Length:234 Identity:109/234 - (46%)
Similarity:136/234 - (58%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 AQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNI------PDGL-----------PGTHLG 486
            |..:...|.||::|||: .|:   :|.|||.||.|:.:      |.||           |....|
  Rat    95 AGPSLFAPLLWERTLPF-GDV---EYVDLDAFLLEHGLPPSPPPPGGLSPAPSPARTPAPSPGPG 155

  Fly   487 HSSGLGHRSDSLGHA-AGLSLGL--GHIT--TKRERSPSPSDCISPDTLN-----PPSPAESTFS 541
            ..|....|| |.||| |..:||.  ||..  |.|: :|||.|   |||:.     .|.||:...|
  Rat   156 SCSSSSPRS-SPGHAPARATLGAAGGHRAGLTSRD-TPSPVD---PDTVEVLMTFEPDPADLALS 215

  Fly   542 FASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKE 606
            .......||||...||:|||||||::||:||..||:|.||:|||:||.|||.||||||||||.||
  Rat   216 SIPGHETFDPRRHRFSEEELKPQPIMKKARKVQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKE 280

  Fly   607 NQIAMRARYLEKENATLHQEVEQLKQENMDLRARLSKFQ 645
            |||::||.:||||||.|.|||..::||....||.||::|
  Rat   281 NQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 39/58 (67%)
coiled coil 581..639 CDD:269843 38/57 (67%)
DbpNP_036675.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..203 27/83 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..255 16/24 (67%)
bZIP_HLF 254..313 CDD:269843 39/58 (67%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 257..279 18/21 (86%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 283..297 9/13 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345401
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1023460at2759
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm44741
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11988
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X901
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.