DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and Tef

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_011243859.1 Gene:Tef / 21685 MGIID:98663 Length:340 Species:Mus musculus


Alignment Length:276 Identity:103/276 - (37%)
Similarity:138/276 - (50%) Gaps:61/276 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 KEEGDIWNVEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIPDGLPGTHLGH------ 487
            ::|....:..|.:|.|.|.:||||:|||.:....:|.||||||.||.||  ...|||..      
Mouse    61 EDESAAASTMAVSASLMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIP--ASPTHLAQNLLLPV 123

  Fly   488 -------------------SSGLGHRSDSLGHAAG------------------------------ 503
                               |:.:...|:::...|.                              
Mouse   124 AELEGKESASSSTASPPSSSTAIFQPSETVSSTASHMEQEDPGARVSQAKTTFSFSYFPVGFWKA 188

  Fly   504 --LSLGLGHITTKRERSPSPSD--CISPDTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQ 564
              :||.|.....|...:|||.|  |:..|....|.||:...|....|..|:||...|::|:||||
Mouse   189 NCISLTLESSLEKERETPSPIDPSCVEVDVNFNPDPADLVLSSVPGGELFNPRKHRFAEEDLKPQ 253

  Fly   565 PMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQ 629
            |||||::|.|||||.||:|||.||:|||:||||||||||.|||||.:||.:|||||..|..||.:
Mouse   254 PMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVAE 318

  Fly   630 LKQENMDLRARLSKFQ 645
            |::|....:..:||::
Mouse   319 LRKEVGKCKTIVSKYE 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 37/58 (64%)
coiled coil 581..639 CDD:269843 36/57 (63%)
TefXP_011243859.1 bZIP_HLF 269..327 CDD:269843 37/57 (65%)
coiled coil 273..324 CDD:269843 34/50 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842008
Domainoid 1 1.000 89 1.000 Domainoid score I7838
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1023460at2759
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm42676
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X901
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
109.810

Return to query results.
Submit another query.