DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and Nfil3

DIOPT Version :10

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_059069.1 Gene:Nfil3 / 18030 MGIID:109495 Length:462 Species:Mus musculus


Alignment Length:132 Identity:43/132 - (32%)
Similarity:63/132 - (47%) Gaps:28/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   512 TTKRERSPSPSDCISPDTLNPPSPAESTF----SFASSGRDFDPRTRAFSDEEL--------KPQ 564
            |.|:|.:|          |:|.|.::...    :.|....|.      .|.|:|        |.:
Mouse     8 TIKKEPAP----------LDPTSSSDKMLLLNSALAEVAEDL------ASGEDLLLNEGSMGKNK 56

  Fly   565 PMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQ 629
            ....:.:::|:|||.||..||.:|||||.||||||:.||..:..:..:...|.:|||||..|:..
Mouse    57 SSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLVLENKLIALGEENATLKAELLS 121

  Fly   630 LK 631
            ||
Mouse   122 LK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 NAM-associated 514..609 CDD:464129 33/106 (31%)
bZIP_HLF 580..639 CDD:269843 26/52 (50%)
coiled coil 581..639 CDD:269843 25/51 (49%)
Nfil3NP_059069.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22 7/23 (30%)
bZIP_NFIL3 72..131 CDD:269842 26/52 (50%)
coiled coil 73..131 CDD:269842 25/51 (49%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 79..95 11/15 (73%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 99..106 0/6 (0%)
Vert_IL3-reg_TF 130..461 CDD:368956
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 188..214
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..298
Necessary for transcriptional repression and sufficient for interaction with PER2. /evidence=ECO:0000269|PubMed:17274955 281..420
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.