DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and atf-8

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_504576.1 Gene:atf-8 / 178998 WormBaseID:WBGene00017535 Length:241 Species:Caenorhabditis elegans


Alignment Length:188 Identity:63/188 - (33%)
Similarity:85/188 - (45%) Gaps:42/188 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 VTQYADLDEFLSENNIPDG---LPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKR------E 516
            :|...|:..:.|..::|..   |..|||.|.:.....:              :.:|:|      .
 Worm    20 LTATFDVSPYSSAFHLPIHPALLSNTHLLHLNTYNPTT--------------YESTERLFEQNNN 70

  Fly   517 RSPSPSDCISPDTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKD 581
            .|.....|.|.|:.:..|...||   ..|.||     ......|||        ||:   |::||
 Worm    71 NSEKAESCSSRDSSHDSSSPTST---GGSSRD-----NVIVRNELK--------RKK---DQVKD 116

  Fly   582 DKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRA 639
            ..||.||||||.|||||||.||.||:::|.||..||:||..|..|::||:.|...|||
 Worm   117 VAYWERRRKNNDAAKRSRDQRRMKEDEMAHRATSLERENMLLRVELDQLRAETDKLRA 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 34/58 (59%)
coiled coil 581..639 CDD:269843 33/57 (58%)
atf-8NP_504576.1 bZIP_HLF 115..174 CDD:269843 34/58 (59%)
coiled coil 119..170 CDD:269843 31/50 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160167581
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.700

Return to query results.
Submit another query.