DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and zip-8

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_498426.1 Gene:zip-8 / 175924 WormBaseID:WBGene00017755 Length:176 Species:Caenorhabditis elegans


Alignment Length:134 Identity:37/134 - (27%)
Similarity:56/134 - (41%) Gaps:35/134 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   534 SPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRS 598
            :|...:|.|..|     |.|...|||.:.....|         |..:..||..:|.|||.|||:|
 Worm    32 NPYNVSFDFTRS-----PNTSGGSDESMSDGSKI---------DPKRSPKYLEKRMKNNEAAKKS 82

  Fly   599 RDARRQKENQIAMRARYLEKENATLHQEVEQLK---------------------QENMDLRARLS 642
            |.:|:.:|.:.......|:::||.|.:|::|.|                     :||..|:...:
 Worm    83 RASRKHREQKNQTENELLKRKNAALEEELKQAKCELAQMQITIRDMSIEREAYRRENEMLKMVNN 147

  Fly   643 KFQD 646
            ||.|
 Worm   148 KFAD 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 23/79 (29%)
coiled coil 581..639 CDD:269843 23/78 (29%)
zip-8NP_498426.1 bZIP_BmCbz-like 68..119 CDD:269875 19/50 (38%)
coiled coil 68..119 CDD:269875 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.