DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and atf-2

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_495861.1 Gene:atf-2 / 174399 WormBaseID:WBGene00000220 Length:401 Species:Caenorhabditis elegans


Alignment Length:294 Identity:61/294 - (20%)
Similarity:103/294 - (35%) Gaps:87/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 SSVQHVANAVAAAVIANEHHNHLNSLKARFQPASSGRKS-PFLGFICKSNGKSTSNSKEIICPDD 426
            :|.|..|:..|:::.::...:..:.    |:|:.|.::| |....|.|...:|..:|.::..|..
 Worm   172 ASTQQPASTSASSLFSSSSSSAFHP----FRPSESAQQSFPSSSVIVKIERRSPDSSTDVNMPQP 232

  Fly   427 KYKEEGDIWNVEAQTA------------FLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIPDG 479
            :.:....:.....|.|            ..||:|                  |...||:......
 Worm   233 QLQPGSSVIQQIGQPAPSGTPQPVIQAVQQGPSL------------------LSALLSQRRPSPT 279

  Fly   480 LPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISPDTLNPPSPAESTFSFAS 544
            :|.:...|.|||.......|                    :.|||.|..:....||:.|:...::
 Worm   280 VPQSRTEHISGLNSPPRHTG--------------------NKSDCESVSSSASFSPSHSSEDHSN 324

  Fly   545 SGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQI 609
                       :|:                     |..:|..|||:||.||||.|..||......
 Worm   325 -----------YSN---------------------KSPQYVDRRRRNNEAAKRCRANRRAVFEYR 357

  Fly   610 AMRARYLEKENATLHQEVEQLKQENMDLRARLSK 643
            :.|.:.||.||..|..::|.||.|....::.|::
 Worm   358 SRRVQLLEGENEDLRTQIETLKAEIAHFKSVLAQ 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 24/58 (41%)
coiled coil 581..639 CDD:269843 23/57 (40%)
atf-2NP_495861.1 bZIP_NFIL3 53..>100 CDD:269842
bZIP_HLF 328..386 CDD:269843 24/57 (42%)
coiled coil 329..386 CDD:269843 23/56 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.