DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and ces-2

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_493610.1 Gene:ces-2 / 173365 WormBaseID:WBGene00000469 Length:211 Species:Caenorhabditis elegans


Alignment Length:132 Identity:56/132 - (42%)
Similarity:64/132 - (48%) Gaps:28/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   521 PSDCISPDTLNPP------------SPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQ 573
            |.|.:....|..|            ||..|..|..||..        ||..:..|      |||.
 Worm    56 PFDSLPTTNLLTPTKKIKLEDELCASPVSSRSSTVSSSH--------FSSPQRSP------SRKM 106

  Fly   574 FV--PDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMD 636
            .|  |:|.||..|:.||||||.|||||||||||||.|||.:|..||:||..|..:|..|:||...
 Worm   107 SVPIPEEKKDSAYFERRRKNNDAAKRSRDARRQKEEQIASKAHALERENMQLRGKVSSLEQEAAQ 171

  Fly   637 LR 638
            ||
 Worm   172 LR 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 37/59 (63%)
coiled coil 581..639 CDD:269843 36/58 (62%)
ces-2NP_493610.1 bZIP_HLF 115..173 CDD:269843 35/57 (61%)
coiled coil 116..173 CDD:269843 34/56 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I6330
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5193
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.800

Return to query results.
Submit another query.