DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and cebp-2

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_871835.1 Gene:cebp-2 / 172319 WormBaseID:WBGene00016754 Length:100 Species:Caenorhabditis elegans


Alignment Length:65 Identity:27/65 - (41%)
Similarity:41/65 - (63%) Gaps:0/65 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   569 KSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQE 633
            :.|....|.|..:|.|..:|::||.|..|:|..:||:||..|.:...|:|||.||.::||||::|
 Worm     5 RKRNTSEPREDDEDDYSTKRKRNNEAVNRTRQKKRQEENDTAEKVDELKKENETLERKVEQLQKE 69

  Fly   634  633
             Worm    70  69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 24/54 (44%)
coiled coil 581..639 CDD:269843 24/53 (45%)
cebp-2NP_871835.1 bZIP_CEBP 16..75 CDD:269841 24/54 (44%)
coiled coil 20..71 CDD:269841 23/50 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.