| Sequence 1: | NP_729301.1 | Gene: | Pdp1 / 45588 | FlyBaseID: | FBgn0016694 | Length: | 647 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001343.2 | Gene: | DBP / 1628 | HGNCID: | 2697 | Length: | 325 | Species: | Homo sapiens |
| Alignment Length: | 236 | Identity: | 101/236 - (42%) |
|---|---|---|---|
| Similarity: | 129/236 - (54%) | Gaps: | 50/236 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 444 LGPNLWDKTLPYDADLKVTQYADLDEFLSENNIP-----------------------------DG 479
Fly 480 LPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISPDTLN-----PPSPAEST 539
Fly 540 FSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQ 604
Fly 605 KENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLSKFQ 645 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Pdp1 | NP_729301.1 | bZIP_HLF | 580..639 | CDD:269843 | 39/58 (67%) |
| coiled coil | 581..639 | CDD:269843 | 38/57 (67%) | ||
| DBP | NP_001343.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..99 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 127..200 | 18/84 (21%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 229..255 | 16/25 (64%) | |||
| bZIP_HLF | 254..313 | CDD:269843 | 39/58 (67%) | ||
| Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 257..279 | 18/21 (86%) | |||
| coiled coil | 258..309 | CDD:269843 | 36/50 (72%) | ||
| Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 | 283..297 | 9/13 (69%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C165151882 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3119 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1023460at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0000980 | |
| OrthoInspector | 1 | 1.000 | - | - | otm40600 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | LDO | PTHR11988 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5193 |
| SonicParanoid | 1 | 1.000 | - | - | X901 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 10 | 9.840 | |||||