DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and cebpd

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_571962.1 Gene:cebpd / 140817 ZFINID:ZDB-GENE-020111-4 Length:280 Species:Danio rerio


Alignment Length:311 Identity:68/311 - (21%)
Similarity:114/311 - (36%) Gaps:94/311 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 NGNGGNPGQNNNNNNGNNSGNSNNNSNNNVSSVQHVANAVAAAVIANEHHNHLNSLKARFQPASS 397
            |.....||:|||||: :::||....||             |.|:..:|                 
Zfish    37 NKGDAKPGENNNNNS-SSTGNMMELSN-------------APAIYDDE----------------- 70

  Fly   398 GRKSPFLGFICKSNGKSTSNSKEIICPDDKYKEEGDIWNVEAQTAFLGPNLWDKTLPYDADLKVT 462
             ....|..:|     :|.|.....||.|:.:   .|::|                          
Zfish    71 -SAIDFSAYI-----ESMSTVPLEICNDELF---ADLFN-------------------------- 100

  Fly   463 QYADLDEFLSENNIPDGLPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISP 527
                       |.:....|..::  |:...|:| :..|..|...|......|:|...|.|:..|.
Zfish   101 -----------NTVKQEKPDFYM--SNTFAHKS-AERHLEGFGKGSFCAPIKKEADWSDSEHSSS 151

  Fly   528 DTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMI-----KKSRKQFVPDELKDDKYWAR 587
            ......:.|:::.:|..:|:...|.|.       :|:|:.     |:..|:.|  :....:|..|
Zfish   152 LPSQIEACAQTSVNFMHTGQPTPPTTP-------EPEPVAHRRPGKEKGKKNV--DRHSPEYRQR 207

  Fly   588 RRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLR 638
            |.:||||.::|||..:|:...:..:...|..||..||:.::||.:|...||
Zfish   208 RERNNIAVRKSRDKAKQRNLDMQQKMIELGAENERLHKTIDQLTRELSSLR 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 21/59 (36%)
coiled coil 581..639 CDD:269843 21/58 (36%)
cebpdNP_571962.1 bZIP 198..262 CDD:304365 21/61 (34%)
coiled coil 204..255 CDD:269834 19/50 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.