Sequence 1: | NP_729301.1 | Gene: | Pdp1 / 45588 | FlyBaseID: | FBgn0016694 | Length: | 647 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571960.1 | Gene: | cebpa / 140815 | ZFINID: | ZDB-GENE-020111-2 | Length: | 288 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 49/200 - (24%) |
---|---|---|---|
Similarity: | 75/200 - (37%) | Gaps: | 43/200 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 455 YDADLKVTQYADLDEFLSENNIPDGLPGT------HLGHSSGLGHRSDSLGHAAGLSLGL--GHI 511
Fly 512 TTKRERSPSPSDCISPDTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVP 576
Fly 577 DELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARL 641
Fly 642 SKFQD 646 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pdp1 | NP_729301.1 | bZIP_HLF | 580..639 | CDD:269843 | 18/58 (31%) |
coiled coil | 581..639 | CDD:269843 | 18/57 (32%) | ||
cebpa | NP_571960.1 | bZIP_CEBPA | 210..270 | CDD:269859 | 18/59 (31%) |
coiled coil | 212..270 | CDD:269859 | 18/57 (32%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3119 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |