DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and cebpa

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_571960.1 Gene:cebpa / 140815 ZFINID:ZDB-GENE-020111-2 Length:288 Species:Danio rerio


Alignment Length:200 Identity:49/200 - (24%)
Similarity:75/200 - (37%) Gaps:43/200 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   455 YDADLKVTQYADLDEFLSENNIPDGLPGT------HLGHSSGLGHRSDSLGHAAGLSLGL--GHI 511
            ||:..::...|...|...|:.:.|.:|.|      |..|.|.|.|:   :.|.|..::.|  ||.
Zfish   113 YDSQARMRPVAIKQEPREEDELGDSMPPTYHHSQHHAPHLSYLQHQ---IAHCAQTTMHLQPGHP 174

  Fly   512 TTKRERSPSPSDCISPDTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVP 576
            |      |.|:...||...:...|..| ......|                      ||:|..  
Zfish   175 T------PPPTPVPSPHHQHSHLPGGS-MKIGDRG----------------------KSKKHV-- 208

  Fly   577 DELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARL 641
             :....:|..||.:||||.::|||..:.:..:...:...|..:|..|.:.||.|.:|...||...
Zfish   209 -DKNSTEYRLRRERNNIAVRKSRDKAKMRNVETQQKVIELSADNDRLRKRVEHLTRELETLRGIF 272

  Fly   642 SKFQD 646
            .:..|
Zfish   273 RQLPD 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 18/58 (31%)
coiled coil 581..639 CDD:269843 18/57 (32%)
cebpaNP_571960.1 bZIP_CEBPA 210..270 CDD:269859 18/59 (31%)
coiled coil 212..270 CDD:269859 18/57 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.