DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and cebpb

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_571959.2 Gene:cebpb / 140814 ZFINID:ZDB-GENE-020111-3 Length:280 Species:Danio rerio


Alignment Length:305 Identity:69/305 - (22%)
Similarity:97/305 - (31%) Gaps:122/305 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 NNGNNSGNSN-NNSNNNVSSVQHVANAVAAAVIANEHHNHLNSLKARFQPASSGRKSPFLGFICK 409
            :.||.|..:. .|..|.:|..:...|.:|...:..      ..:.|.|.|       .|:|...|
Zfish    85 SEGNKSKRAALQNYKNYISLTERDPNQLAYPELQE------TRIDAVFSP-------DFMGSFAK 136

  Fly   410 SNGKSTSNSKEIICPDDKYKEEGDIWNVEAQTAFLGPNLWD--KTLPYDADLKVTQYADLDEFLS 472
            |||:                        ..:|...||..:|  ..|||                 
Zfish   137 SNGR------------------------HEETPMDGPGGYDMRSYLPY----------------- 160

  Fly   473 ENNIPDGLPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISPDTLNPPSPAE 537
             ...|.|                           .||:|:|      :.|.|.||    |.:||.
Zfish   161 -QTAPSG---------------------------SLGNIST------ASSSCSSP----PGTPAP 187

  Fly   538 STFSFASSGRDFDPRTRAFSDEELKPQPMIK-----KSRKQFVPDELKDDKYWARRRKNNIAAKR 597
            |     ..||              .||...|     |.:|:...|   .|:|..||.:||:|.::
Zfish   188 S-----GKGR--------------SPQAGGKMTSSGKGKKRLDKD---SDEYRQRRERNNLAVRK 230

  Fly   598 SRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLS 642
            |||..:.:..:...:...|..||..|.:.||||.:|...||..||
Zfish   231 SRDKAKMRNLETQHKVLELAAENDRLQKRVEQLSRELATLRNLLS 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 20/58 (34%)
coiled coil 581..639 CDD:269843 20/57 (35%)
cebpbNP_571959.2 bZIP_CEBPB 207..277 CDD:269860 25/72 (35%)
coiled coil 214..275 CDD:269860 21/60 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.