DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and Ddit3

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_030100727.1 Gene:Ddit3 / 13198 MGIID:109247 Length:182 Species:Mus musculus


Alignment Length:210 Identity:41/210 - (19%)
Similarity:71/210 - (33%) Gaps:86/210 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   435 WNVEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIPDGLPGTHLGHSSGLGHRSDSLG 499
            |.:||         |              |.||.|.||.    |.:.||::.             
Mouse    30 WELEA---------W--------------YEDLQEVLSS----DEIGGTYIS------------- 54

  Fly   500 HAAGLSLGLGHITTKRERSPSPSDCISPDTLNPPSPAESTFSFASSGRDFDPRTRAFSDEELKPQ 564
                                           :|.:..|.:.:|.:    .||.:.|:..||..|.
Mouse    55 -------------------------------SPGNEEEESKTFTT----LDPASLAWLTEEPGPT 84

  Fly   565 PMIKKSRKQFVPD---------ELKDDKYWARRRKNN--IAAKRSRDARRQKENQIAMRARYLEK 618
            .:.:.|:....||         |.::::...|:||.:  ..|:..:...::||.:...:...|.:
Mouse    85 EVTRTSQSPRSPDSSQSSMAQEEEEEEQGRTRKRKQSGQCPARPGKQRMKEKEQENERKVAQLAE 149

  Fly   619 ENATLHQEVEQLKQE 633
            ||..|.||:|:|.:|
Mouse   150 ENERLKQEIERLTRE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 15/56 (27%)
coiled coil 581..639 CDD:269843 15/55 (27%)
Ddit3XP_030100727.1 BRLZ 114..174 CDD:197664 15/51 (29%)
coiled coil 116..166 CDD:269834 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.