DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and Dbp

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_058670.2 Gene:Dbp / 13170 MGIID:94866 Length:325 Species:Mus musculus


Alignment Length:234 Identity:109/234 - (46%)
Similarity:136/234 - (58%) Gaps:36/234 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   439 AQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNI------PDGL-----------PGTHLG 486
            |..:...|.||::|||: .|:   :|.|||.||.|:.:      |.||           |....|
Mouse    95 AGPSLFAPLLWERTLPF-GDV---EYVDLDAFLLEHGLPPSPPPPGGLSPAPSPARTPAPSPGPG 155

  Fly   487 HSSGLGHRSDSLGHA-AGLSLGL--GHIT--TKRERSPSPSDCISPDTLN-----PPSPAESTFS 541
            ..|....|| |.||| |..:||.  ||..  |.|: :|||.|   |||:.     .|.||:...|
Mouse   156 SCSSSSPRS-SPGHAPARATLGAAGGHRAGLTSRD-TPSPVD---PDTVEVLMTFEPDPADLALS 215

  Fly   542 FASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKE 606
            .......||||...||:|||||||::||:||..||:|.||:|||:||.|||.||||||||||.||
Mouse   216 SIPGHETFDPRRHRFSEEELKPQPIMKKARKVQVPEEQKDEKYWSRRYKNNEAAKRSRDARRLKE 280

  Fly   607 NQIAMRARYLEKENATLHQEVEQLKQENMDLRARLSKFQ 645
            |||::||.:||||||.|.|||..::||....||.||::|
Mouse   281 NQISVRAAFLEKENALLRQEVVAVRQELSHYRAVLSRYQ 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 39/58 (67%)
coiled coil 581..639 CDD:269843 38/57 (67%)
DbpNP_058670.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..98 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..203 27/83 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 230..256 17/25 (68%)
bZIP_HLF 254..313 CDD:269843 39/58 (67%)
coiled coil 255..313 CDD:269843 38/57 (67%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 257..279 18/21 (86%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 283..297 9/13 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842006
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm42676
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11988
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5193
SonicParanoid 1 1.000 - - X901
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.830

Return to query results.
Submit another query.