DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and Cebpb

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_034013.1 Gene:Cebpb / 12608 MGIID:88373 Length:296 Species:Mus musculus


Alignment Length:278 Identity:65/278 - (23%)
Similarity:102/278 - (36%) Gaps:69/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   365 VQHVANAVAAAVIANEHHNHLNSLKARFQPASSGRKSPFLGFICKSNGKSTSNSKEIIC----PD 425
            ::.:|.|...|..|..||:.|:.|.|....|...:|....|::  |.|::.:.:....|    |.
Mouse    67 LEPLAPAADFAAPAPAHHDFLSDLFADDYGAKPSKKPADYGYV--SLGRAGAKAAPPACFPPPPP 129

  Fly   426 DKYKEEGDIWNVEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIPDGLPGTHLGHSSG 490
            ...|.|......:.:.|                                   |..|....|....
Mouse   130 AALKAEPGFEPADCKRA-----------------------------------DDAPAMAAGFPFA 159

  Fly   491 LGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISPDTLNPPSPAESTFSFASSGRDFDPRTRA 555
            |   ...||:.|..|...|.::|....||       |.|   ||||::..:.|:          .
Mouse   160 L---RAYLGYQATPSGSSGSLSTSSSSSP-------PGT---PSPADAKAAPAA----------C 201

  Fly   556 FSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKEN 620
            |:.....|    .|::.:...|:|.|: |..||.:||||.::|||..:.:..:...:...|..||
Mouse   202 FAGPPAAP----AKAKAKKTVDKLSDE-YKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAEN 261

  Fly   621 ATLHQEVEQLKQENMDLR 638
            ..|.::||||.:|...||
Mouse   262 ERLQKKVEQLSRELSTLR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 22/59 (37%)
coiled coil 581..639 CDD:269843 22/58 (38%)
CebpbNP_034013.1 Required for Lys-133 sumoylation. /evidence=ECO:0000250|UniProtKB:P17676 1..22
Required for MYC transcriptional repression. /evidence=ECO:0000269|PubMed:16585579 22..104 11/36 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..199 11/37 (30%)
bZIP_CEBPB 215..285 CDD:269860 24/66 (36%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..246 9/19 (47%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 248..255 0/6 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.