DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and Cebpe

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_997014.1 Gene:Cebpe / 110794 MGIID:103572 Length:281 Species:Mus musculus


Alignment Length:280 Identity:61/280 - (21%)
Similarity:94/280 - (33%) Gaps:60/280 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 QHVANAVAAAVIANEHHNHLNSLKARFQPASSGRK-----SPFLGFICKSNGKSTSNSKEIICPD 425
            :|.|:...:|.|.:.....|:.|.| .:|....|.     :|.......::.:..:.......||
Mouse    35 EHEASIDLSAYIESGEEQLLSDLFA-MKPTPEARSLKGPGAPSFPHYLPADPRPFAYPSHTFGPD 98

  Fly   426 DKYKEEGDIWNVEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLSENNIPDGLPGTHLGHSSG 490
            .|               .|||.::.....||......:        .|...|:|..||..|..:.
Mouse    99 RK---------------ALGPGIYSNPGSYDPRAVAVK--------EEPRGPEGNRGTSRGSYNP 140

  Fly   491 LGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISPDTLNPPSPAESTFS--FASSGRDFDPRT 553
            |.::....|..|      .|:               |.||..|........  .|::.....|..
Mouse   141 LQYQVAHCGQTA------VHL---------------PPTLAAPGQPLRVLKAPVAAAAPPCSPLL 184

  Fly   554 RAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEK 618
            :|.|     |.....|.:|....|.|   :|..||.:||||.::|||..:::..:...:......
Mouse   185 KAPS-----PAGPSHKGKKAVNKDSL---EYRLRRERNNIAVRKSRDKAKRRIMETQQKVLEYMA 241

  Fly   619 ENATLHQEVEQLKQENMDLR 638
            ||..|...|:||.||...||
Mouse   242 ENERLRNRVDQLTQELDTLR 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 20/59 (34%)
coiled coil 581..639 CDD:269843 20/58 (34%)
CebpeNP_997014.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30
bZIP_CEBPE 202..262 CDD:269863 22/63 (35%)
coiled coil 204..262 CDD:269863 21/61 (34%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 208..245 11/36 (31%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 246..267 8/16 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.