DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and CEBPG

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001239225.1 Gene:CEBPG / 1054 HGNCID:1837 Length:150 Species:Homo sapiens


Alignment Length:177 Identity:42/177 - (23%)
Similarity:66/177 - (37%) Gaps:59/177 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 LSENNIPDGLPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKRERSPSPSDCISPDTLNPPSP 535
            :|:.|...|:.|..:.|:.         .||:||           ::.|.         |.|..|
Human     4 ISQQNSTPGVNGISVIHTQ---------AHASGL-----------QQVPQ---------LVPAGP 39

  Fly   536 AESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRD 600
                   ...|:...|     |.:..|..||.:.|           |:|..||.:||:|.|:||.
Human    40 -------GGGGKAVAP-----SKQSKKSSPMDRNS-----------DEYRQRRERNNMAVKKSRL 81

  Fly   601 ARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRARLSKFQDV 647
            ..:||......|...|::||..|..:::.|.:|       ||..:|:
Human    82 KSKQKAQDTLQRVNQLKEENERLEAKIKLLTKE-------LSVLKDL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 19/58 (33%)
coiled coil 581..639 CDD:269843 19/57 (33%)
CEBPGNP_001239225.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..94 25/109 (23%)
bZIP_CEBPG 60..120 CDD:269861 22/77 (29%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 66..93 10/26 (38%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 97..118 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.