DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and CEBPD

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_005186.2 Gene:CEBPD / 1052 HGNCID:1835 Length:269 Species:Homo sapiens


Alignment Length:188 Identity:55/188 - (29%)
Similarity:85/188 - (45%) Gaps:34/188 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   464 YADLDEFLSENNIPDG------LPGTHLGHSSGLGHRSDSLGHAAGLSLGLGHITTKRERSPSPS 522
            :|||   .:.|:...|      |||   |.:..||.     |.||...|         :|.|...
Human    82 FADL---FNSNHKAGGAGPLELLPG---GPARPLGP-----GPAAPRLL---------KREPDWG 126

  Fly   523 DCISPDTLNP---PSPAESTFSFASSGRDFDPRT----RAFSDEELKPQPMIKKSRKQFVPDELK 580
            |..:|.:|.|   .:.|::..|.|::|:...|.:    |:...:...|.|..:||..:..||. .
Human   127 DGDAPGSLLPAQVAACAQTVVSLAAAGQPTPPTSPEPPRSSPRQTPAPGPAREKSAGKRGPDR-G 190

  Fly   581 DDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLR 638
            ..:|..||.:||||.::|||..:::..::..:...|..||..|||.||||.::...||
Human   191 SPEYRQRRERNNIAVRKSRDKAKRRNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLR 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 22/59 (37%)
coiled coil 581..639 CDD:269843 22/58 (38%)
CEBPDNP_005186.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..48
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 97..133 14/52 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 151..219 19/68 (28%)
bZIP_CEBPD 188..252 CDD:269862 23/62 (37%)
coiled coil 191..249 CDD:269862 22/58 (38%)
Basic motif. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 195..222 9/26 (35%)
Leucine-zipper. /evidence=ECO:0000255|PROSITE-ProRule:PRU00978 226..254 12/23 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.