DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and CEBPA

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:NP_001274353.1 Gene:CEBPA / 1050 HGNCID:1833 Length:393 Species:Homo sapiens


Alignment Length:160 Identity:42/160 - (26%)
Similarity:62/160 - (38%) Gaps:19/160 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   481 PGTHLGHSSGLGHRSDSLGHAAGLSLGL--GHITTKRERSPSPSDCISPDTLNPPSPAESTFSFA 543
            |..||    ...|....:.|....::.|  ||.|      |.|:...||.    |:||.......
Human   232 PPAHL----AAPHLQFQIAHCGQTTMHLQPGHPT------PPPTPVPSPH----PAPALGAAGLP 282

  Fly   544 SSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQ 608
            ..|........|..|..........|::|..   :...::|..||.:||||.::|||..:|:..:
Human   283 GPGSALKGLGAAHPDLRASGGSGAGKAKKSV---DKNSNEYRVRRERNNIAVRKSRDKAKQRNVE 344

  Fly   609 IAMRARYLEKENATLHQEVEQLKQENMDLR 638
            ...:...|..:|..|.:.||||.:|...||
Human   345 TQQKVLELTSDNDRLRKRVEQLSRELDTLR 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 21/59 (36%)
coiled coil 581..639 CDD:269843 21/58 (36%)
CEBPANP_001274353.1 bZIP_CEBPA 315..375 CDD:269859 21/60 (35%)
coiled coil 317..375 CDD:269859 21/58 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3119
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.