DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and dbp

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_002938324.1 Gene:dbp / 100494503 XenbaseID:XB-GENE-5995286 Length:311 Species:Xenopus tropicalis


Alignment Length:283 Identity:109/283 - (38%)
Similarity:142/283 - (50%) Gaps:38/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 PASSGRKSPFLGFICKSNGKSTSNSKEIICPDDKYKEEGDIWNVE-AQTAFLGPNLWDKTLPYDA 457
            |.....||...|.| |...:.|......|..:.:.|.|.|:.... |..||||..||::||||:.
 Frog    30 PGMVSLKSLLQGPI-KGTDRRTRELSNCIMKEKERKLEDDMTGPRPAHCAFLGSLLWERTLPYNE 93

  Fly   458 DLKVTQYADLDEFLSENNIPDGLPGTHLGHSSG-------------LGHRSDSLGHAAGLSLGL- 508
                .:|.||||||.||.:|...|  |...|..             |...:......:..|..: 
 Frog    94 ----IEYVDLDEFLRENGLPPSPP--HQPFSPANLTPPPSNQSVVDLSRPASCASSTSACSSPVQ 152

  Fly   509 GHITTKRERSPSPSDCISPDTLNPPSPAES----------------TFSFASSGRDFDPRTRAFS 557
            ..|.::.|...|.:..::|.:.:.||||.|                ..|.......||||...||
 Frog   153 SMIDSEYEHPSSQAGQMTPGSRDSPSPANSESLEVISNFDLDPTDLALSSVPGHETFDPRKHRFS 217

  Fly   558 DEELKPQPMIKKSRKQFVPDELKDDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENAT 622
            :|||||||::||:||..||:|.||:|||.||.|||.||||||||||.|||||.:||.:|||||:.
 Frog   218 EEELKPQPIMKKARKIQVPEEQKDEKYWNRRYKNNEAAKRSRDARRLKENQITVRAAFLEKENSV 282

  Fly   623 LHQEVEQLKQENMDLRARLSKFQ 645
            |.|||.:::||....|..|||::
 Frog   283 LRQEVAKIRQELSRYRNILSKYE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 38/58 (66%)
coiled coil 581..639 CDD:269843 37/57 (65%)
dbpXP_002938324.1 Stk19 30..>123 CDD:371090 35/99 (35%)
bZIP_HLF 240..299 CDD:269843 38/58 (66%)
coiled coil 241..299 CDD:269843 37/57 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8126
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1023460at2759
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm47776
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X901
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.