DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pdp1 and hlf

DIOPT Version :9

Sequence 1:NP_729301.1 Gene:Pdp1 / 45588 FlyBaseID:FBgn0016694 Length:647 Species:Drosophila melanogaster
Sequence 2:XP_004918616.1 Gene:hlf / 100489797 XenbaseID:XB-GENE-955698 Length:296 Species:Xenopus tropicalis


Alignment Length:265 Identity:117/265 - (44%)
Similarity:148/265 - (55%) Gaps:42/265 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   408 CKSNGKSTSNSKEIICPDDKYKEEGDIWNVEAQTAFLGPNLWDKTLPYDADLKVTQYADLDEFLS 472
            ||...|            :|..|:.:..:...|:|||||.|||||||||.|....:|.||:||||
 Frog    41 CKEKEK------------EKKLEDDNTTSTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLS 93

  Fly   473 ENNIPDGLPGTHLGH-------SSGLGHRSDSLGHAAGLSL--GL------------GHITTKRE 516
            ||.||.......|.|       :|........|.:.|..|:  ||            |.|.|...
 Frog    94 ENGIPPSQSSHELSHHQPSHPQASATSPSVIDLSNRASTSVLPGLVPHNCMHSPVRPGQILTANR 158

  Fly   517 RSPSPSDCISPDTLN-----PPSPAESTFSFASSGRDFDPRTRAFSDEELKPQPMIKKSRKQFVP 576
            .:|||   |.|:::.     .|.||:...|.......||||.|.||:|||||||||||:||.|:|
 Frog   159 NTPSP---IDPESIQVAVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIP 220

  Fly   577 DELK-DDKYWARRRKNNIAAKRSRDARRQKENQIAMRARYLEKENATLHQEVEQLKQENMDLRAR 640
            |:|| |:||||||:|||:||||||||||.||||||:||.:|||||:.|..||..|::|....:..
 Frog   221 DDLKQDEKYWARRKKNNLAAKRSRDARRLKENQIAIRASFLEKENSALRMEVADLRKELGKCKNI 285

  Fly   641 LSKFQ 645
            |:|::
 Frog   286 LAKYE 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pdp1NP_729301.1 bZIP_HLF 580..639 CDD:269843 39/59 (66%)
coiled coil 581..639 CDD:269843 38/57 (67%)
hlfXP_004918616.1 bZIP_HLF 226..284 CDD:269843 38/57 (67%)
coiled coil 226..284 CDD:269843 38/57 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I8126
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31074
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1023460at2759
OrthoFinder 1 1.000 - - FOG0000980
OrthoInspector 1 1.000 - - otm47776
Panther 1 1.100 - - O PTHR11988
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5193
SonicParanoid 1 1.000 - - X901
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.050

Return to query results.
Submit another query.