DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment nompA and qsm

DIOPT Version :9

Sequence 1:NP_524831.2 Gene:nompA / 45587 FlyBaseID:FBgn0016047 Length:1557 Species:Drosophila melanogaster
Sequence 2:NP_001286637.1 Gene:qsm / 47065 FlyBaseID:FBgn0028622 Length:414 Species:Drosophila melanogaster


Alignment Length:358 Identity:89/358 - (24%)
Similarity:147/358 - (41%) Gaps:77/358 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly  1026 CNEEGMEFTIRTPEG-----FLGRIYTYGFY----DRCFFRGNGGTVNVLRLSGPQGYPDCGTQR 1081
            |:|:.|...|..|:.     ...:||..|..    :||..:.: |::.|.|||....| :||..|
  Fly    31 CSEDQMRVDIGLPDAESKDQSAPQIYLEGLKGYPDERCQPQID-GSLAVFRLSLSDFY-ECGVTR 93

  Fly  1082 YGDTLT------NIVVVQFSDNVQ-------TSRDKRYNL----------TCIFRGPGEAVVSSG 1123
            ..:.||      :.::::.:...:       |:....||:          |....|....:|...
  Fly    94 MVNQLTGKKVYYHKIIIESTSGKEIVSVKCITTASPAYNVMMNATTGSSSTSTSSGGIHGLVKRD 158

  Fly  1124 YIGAGSGSPIPIEYLPAENTLSSKVRLSI--LYQGRPTT---TIAVGDPLTFRLEAQD------- 1176
            .:.||...|..:|...:....:.:.||||  ...|:..|   |:..|.|||..:...:       
  Fly   159 VLPAGFQEPEDLEITTSLTKRAPEPRLSIGVSQDGQKFTRDLTVKSGTPLTMEINLDEDSAPVYG 223

  Fly  1177 -GYNH--VTDIFATNVVARDPYSGRSIQLIDRFGCPVDPFVFPELDKLRDGDTLEARFNAFKIPE 1238
             |.|:  |||...:           |..||.: ||.|||::|...:.: |||.|.|:|.|||.|:
  Fly   224 LGVNYLDVTDTHTS-----------SETLIFK-GCTVDPYLFENFNTI-DGDILSAKFKAFKFPD 275

  Fly  1239 SNFLVFEATVRSCREGCQPAYCPGPAGRQEPSFGRRRRSLNTTEIPEPEALA-------LEGSSQ 1296
            |:::.|.|||..|.:.|....|    ...:..||||:|.:::.......:||       :||.::
  Fly   276 SSYVQFRATVNVCLDKCLGTQC----SNNQVGFGRRKREISSANKVYEISLAMFLQVQDIEGVNK 336

  Fly  1297 LEASTLD----EVTVVNSTTVSATLGQVPLNET 1325
            .|...|:    |:.:.|......:.|...:.:|
  Fly   337 NEVLQLEEKLRELKLANQRLARNSRGNFAMEQT 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
nompANP_524831.2 PAN_AP_HGF 150..231 CDD:238532
PAN_AP_HGF 244..>303 CDD:238532
PAN_AP_HGF 349..424 CDD:238532
PAN_AP_HGF 914..1011 CDD:238532
ZP 1025..1264 CDD:214579 74/284 (26%)
qsmNP_001286637.1 ZP 30..298 CDD:214579 74/285 (26%)
Zona_pellucida <200..300 CDD:278526 37/116 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28JEZ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47327
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.